Страница 79


AMÉLIORATION EN COMPÉTITIVITÉAMÉLIORATION FONCTIONNELLE
AMÉLIORATION INDUSTRIELLEAMÉLIORATION NEUROLOGIQUE
AMELIORATION OF WATER BODIES FOR FISH CULTUREAMÉLIORATION SIGNIFICATIVE
AMÉLIORATION SPECTACULAIREAMÉLIORATION SPONTANÉE
AMÉLIORATION TECHNIQUEAMÉLIORATION TRANSITOIRE
AMELIORATION WASTEAMELIORATIONS
AMELIORATIVEAMELIORATIVE EFFECT
AMELIORATORAMÉLIORER
AMELIORIERENAMELIOS
AMELIOTORYAMELITIT
AMELIUS, S.AMELIY
AMELIYATAMELIYATHANE
AMELIYATLA\ ALMAKAMELIYE
AMELKORNAMELLAR
AMELLETTÅMELLOM
AMELLUSAMELMARDUK
AMELOAMELOBLAST
AMÉLOBLASTEAMELOBLASTIC
AMELOBLASTIC HEMANGIOMAAMELOBLASTIC LAYER
AMELOBLASTIC ODONTOMAAMELOBLASTIC SARCOMA
AMELOBLASTIC TUMORAMELOBLASTO
AMELOBLASTOMAMELOBLASTOMA
AMÉLOBLASTOMEAMELOBLASTS
AMELOCOTONADOAMELODENTINAL
AMELOGENESISAMELOGENESIS IMPERFECTA
AMELOGENICAMELOGENIN
AMELOGENINSAMELONADO
AMELONARSEAMELOTE, DENIS
AMELPERESTAMELTRUDIS, S.
AMELUNGAMELUNGE
AMELUNGENAMELUNGSBORN
AMELUSAMELY
AMELYIKAMÉM
AMENAMÉN
ÁMENAMEN CORNER
AMEN COURTAMÉN DE
AMEN HOUSEAMEN LANE
AMEN RAAMEN!
AMENÁBAR, ALEJANDROAMENABILITY
AMENABILITY IN RESPECT OF A SUITAMENABLE
AMENABLE ALGEBRAAMENABLE GROUP
AMENABLE INDUSTRIAL WASTEAMENABLE INDUSTRIAL WASTES
AMENABLE OREAMENABLE SEMIGROUP
AMENABLE STRUCTUREAMENABLE SUBGROUP
AMENABLE TOAMENABLE TO DIRECT CYANIDATION
AMENABLE TO DISCIPLINEAMENABLE TO FLATTERY
AMENABLE TO HEAT TREATMENTAMENABLE TO JUSTICE
AMENABLE TO LAWAMENABLE TO NEGOTIATIONS
AMENABLE TO PERSUASIONAMENABLE TO PUNISHMENT
AMENABLE TO SURGERYAMENABLE TO TRIBUNAL
AMENABLYAMENABLY TO THE RULES
AMENAGEAMÉNAGÉ
AMÉNAGEABLEAMÉNAGEMENT
AMÉNAGEMENT À BUTS MULTIPLESAMÉNAGEMENT À L'EXÉCUTION DES PEINES
AMÉNAGEMENT D'HORAIRESAMÉNAGEMENT DE BASSE CHUTE
AMÉNAGEMENT DE L'INFRASTRUCTUREAMÉNAGEMENT DE LA PENTE
AMÉNAGEMENT DES POUVOIRSAMÉNAGEMENT DU SITE
AMÉNAGEMENT DU TERRAINAMÉNAGEMENT DU TERRITOIRE
AMÉNAGEMENT FAMILIAL DE L'IMPÔTAMÉNAGEMENT FONCIER
AMÉNAGEMENT HYDROAGRICOLEAMÉNAGEMENT INTERNE
AMÉNAGEMENT JURIDIQUEAMÉNAGEMENT THERMIQUE
AMÉNAGEMENT URBAINAMÉNAGEMENTS DE STRUCTURE
AMÉNAGERAMÉNAGEUR
AMÉNAGEUSEAMÉNAGISTE
AMENAJAAMENAJARE
AMENANUSAMENARDIS I
AMENARDIS IIAMENAZA
AMENAZA ANÓNIMAAMENAZA CON ARMAS
AMENAZA DE MUERTEAMENAZA DE UN MAL
AMENAZA ESCRITAAMENAZA VERBAL
AMENAZADORAMENAZANTE
AMENAZARAMENCIA
AMENDAMEND ... ACT
AMEND ... ARTICLESAMEND ... CONSORTIUM AGREEMENT
AMEND ... LEGISLATIVE ACTSAMEND ... LETTER OF CREDIT
AMEND A BILLAMEND A CHARTER
AMEND A CONSORTIUM AGREEMENTAMEND A CONSTITUTION
AMEND A CONTRACTAMEND A DRAFT RESOLUTION
AMEND A LETTER OF CREDITAMEND A PASSPORT
AMEND A PLEADINGAMEND A PROPOSAL
AMEND A REPORTAMEND A RESOLUTION
AMEND A TREATYAMEND ACCEPTANCE INPUT
AMEND ADVANCES INPUTAMEND AN ACT
AMEND AN AGREEMENTAMEND AN AMENDMENT
AMEND AN ARTICLEAMEND ARRANGEMENTS
AMEND COLLECTION INPUTAMEND CREDIT INPUT
AMEND GUARANTEE INPUTAMEND LEGISLATIVE ACTS
AMEND OPPONENT'S PLEADINGAMEND PASSPORT
AMEND RULESAMEND THE CONSTITUTION
AMEND THE DRAFT RESOLUTION IN THE WAY PROPOSESAMEND THE PROCEDURE
AMEND THE TEXT OF A BILLAMEND THE TEXT OF A DRAFT LAW
AMEND TO THE CONSTITUTIONAMEND, KARLE OTTO
AMENDAAMENDABIL
AMENDABLEAMENDABLE PROCESS
AMENDAMENTAMENDARE
AMENDATORYAMENDATORY ABSTRACT
AMENDATORY PROCEDUREAMENDATORY PROCESS
AMENDATORY PROVISIONAMENDATORY STATUTE
AMENDEAMENDE ADMINISTRATIVE
AMENDE CIVILEAMENDE CONVENTIONNELLE
AMENDE CORRECTIONNELLEAMENDE DE COMPOSITION
AMENDE DE SIMPLE POLICEAMENDE DE SUBSTITUTION
AMENDE DISCIPLINAIREAMENDE DOUANIÈRE
AMENDE EN NATUREAMENDE FISCALE
AMENDE FORESTIÈREAMENDE FORFAITAIRE
AMENDE HONORABLEAMENDE MOYENNE
AMENDE PÉNALEAMENDE POUR LE DÉVERSEMENT DES EFFLUENTS NON ÉPURÉS
AMENDE TRANSACTIONNELLEAMENDED
AMENDED ACTAMENDED ANSWER
AMENDED APPLICATIONAMENDED ARTICLE
AMENDED BUDGETAMENDED CLAIM
AMENDED CLASSAMENDED CLASSIFICATION
AMENDED CLEARANCEAMENDED COMPLAINT
AMENDED DEVELOPMENT PLANAMENDED DRAFT RESOLUTION
AMENDED FORECASTAMENDED FROM
AMENDED IN THE WAY PROPOSEDAMENDED LAW
AMENDED LEGISLATIONAMENDED LIST
AMENDED MINIMUMAMENDED PLAN
AMENDED PLEADINGAMENDED RESOLUTION
AMENDED RESOURCESAMENDED RETURN
AMENDED SCHEMEAMENDED SPECIFICATION
AMENDED STATUTEAMENDED TAX RETURN
AMENDED TRADEMARKAMENDED TRADEMARK REGISTRATION
AMENDED VERSIONAMENDEHONORABLE
AMENDEMENTAMENDEMENT À LA CONSTITUTION
AMENDEMENT AU TRAITÉAMENDEMENT AUX STATUTS
AMENDEMENT DE SUPPRESSIONAMENDEMENT DES TRAITÉS
AMENDEMENT DU CONDAMNÉAMENDEMENT ÉCRIT
AMENDEMENT LÉGISLATIFAMENDEMENT ORAL
AMENDEMENT PAR PROCÉDURE SIMPLIFIÉEAMENDEMENT PAR UNE CONFÉRENCE
AMENDEMENT RÉDACTIONNELAMENDER
AMENDERENAMENDIEREN
AMENDIERUNGAMENDING
AMENDING A LETTER OF CREDITAMENDING ACT
AMENDING AGREEMENTAMENDING AN ACT
AMENDING BILLAMENDING BUDGET
AMENDING CLAUSEAMENDING LEGISLATION
AMENDING PASSPORTAMENDING POWER
AMENDING PROCESSAMENDING STATUTE
AMENDMENTAMENDMENT AGREEMENT
AMENDMENT AND COORDINATION MESSAGEAMENDMENT AND WAIVER
AMENDMENT AS OF COURSEAMENDMENT BY COMPULSION
AMENDMENT BY WAY OF DISCLAIMERAMENDMENT BY WAY OF EXPLANATION
AMENDMENT DRAFTINGAMENDMENT FILE
AMENDMENT FURTHEST REMOVED IN SUBSTANCE FROM THE ORIGINAL PROPOSALAMENDMENT IN A DRAFT
AMENDMENT IN ITS PRESENT FORMAMENDMENT IN WRITING
AMENDMENT LISTAMENDMENT OF A CLAIM
AMENDMENT OF A DOCUMENTAMENDMENT OF A STATUTE
AMENDMENT OF AMENDMENTSAMENDMENT OF AN ACT
AMENDMENT OF ARTICLES OF ASSOCIATIONAMENDMENT OF BOUNDARY
AMENDMENT OF CLAIMAMENDMENT OF CONSTITUTION
AMENDMENT OF INCOME TAX RETURNAMENDMENT OF INFORMATION
AMENDMENT OF ITEMSAMENDMENT OF JUDGEMENT
AMENDMENT OF JUDGMENTAMENDMENT OF LEGISLATION
AMENDMENT OF PATENTAMENDMENT OF PLEADING
AMENDMENT OF SOILAMENDMENT OF SPECIFICATION
AMENDMENT OF STATUTEAMENDMENT OF SUBSTANCE
AMENDMENT OF TERMSAMENDMENT OF THE CONSTITUTION
AMENDMENT ON A POINT OF FORMAMENDMENT PROCEDURE
AMENDMENT RECORDAMENDMENT RIGHT
AMENDMENT TAPEAMENDMENT TO A BILL
AMENDMENT TO A CONTRACTAMENDMENT TO A TREATY
AMENDMENT TO AN ACTAMENDMENT TO AN AMENDMENT
AMENDMENT TO AN ARTICLEAMENDMENT TO CONFORM TO PROOF
AMENDMENT TO DEVELOPMENT PLANAMENDMENT TO THE BUDGET
AMENDMENT TO THE CONSTITUTIONAMENDMENT TO THE PROJECT
AMENDMENTSAMENDMENTS APPROVED BY THE GENERAL ASSEMBLY
AMENDMENTS FILEAMENDMENTS THERETO
AMENDMENTS TO AN ARTICLEAMENDMENTS TO DEVELOPMENT PLANS AND DEVELOPMENT BUDGETS
AMENDMENTS TO THE ARTICLES OF THE UN CHARTERAMENDMENTS TO THE CHARTER
AMENDMENTS TO THE INTERNATIONAL CONVENTION FOR THE PREVENTION OF POLLUTION OF THE SEA BY OIL, 1954, CONCERNING THE PROTECTION ON THE GREAT BARRIER REEFAMENDO
AMÊNDOAAMÊNDOA DE CRISTAL
AMENDOADAAMENDOADO
AMENDOALAMENDOEIRA
AMENDOIMAMENDOLA
AMENDOLA, FERRUCCIOAMENDOLA, GIORGIO
AMENDOLA, GIOVANNIAMENDS
AMENEAMÈNE
AMÈNE TES OS!AMENÉE
AMENÉE CARBURANTAMENÉE D'AIR
AMENÉE D'AIR FORCÉEAMENÉE D'AIR PAR CONVECTION
AMENÉE D'EAUAMENÉE D'EAU D'APPOINT
AMENÉE D'HUILEAMENÉE DE CHALEUR
AMENÉE DE COMBUSTIBLEAMENÉE DE COURANT
AMENÉE DE GAZAMENÉE DE NUMIDIE EN TROIS QUARRAQUES ET UN BRIGANTIN.
AMENÉE DE VAPEURAMENÉE DU COMBUSTIBLE
AMENÉE DU FLUIDE DE PURGEAMENÉE DU FRIGORIGÈNE
AMENEMHATAMENEMHAT I
AMENEMHAT IIAMENEMHAT III
AMENEMHAT IVAMENEMHAT V
AMENEMHAT VIAMENEMHAT VII
AMENEMHETAMENEMNISU
AMENEMOPEAMENEMOPE, KING
AMENERAMENER À COMPOSITION
AMENER À JUBÉAMENER DE TRÈS LOIN
AMENER DES HISTOIRES À QNAMENER L'EAU AU MOULIN
AMENER LA COUVERTURE À SOIAMENER SA VIANDE
AMENER SES COULEURSAMENER SUR LE TERRAIN
AMENGUAMIENTOAMENGUAR
AMENHERKHEPESHEFAMENHIRKHOPSHEF
AMENHOTEPAMENHOTEP I
AMENHOTEP IIAMENHOTEP III
AMENHOTEP IVAMENHOTEP, HIGHPRIESTOFAMUN
AMENIAMENIA
AMENIDADAMENIDADE
AMENINADOAMENINARSE
AMENINŢAAMENINŢARE
AMENINŢATAMENINŢĂTOR
AMENIRDISAMENITÀ
AMENITATEAMÉNITÉ
AMENITIESAMENITIES OF ECONOMIC GROWTH
AMENITIES OF HOME LIFEAMENITIES OF LIFE
AMENITIES OF NATUREAMENITIES OF RURAL LIFE
AMENITIES OF SEAAMENITIES OF THE COUNTRYSIDE
AMENITIES OF URBAN LIFEAMENITIES, SOCIAL
AMENITOAMENITY
AMENITY BEDAMENITY DAMAGES
AMENITY FORESTAMENITY GRASS
AMENITY LOSSAMENITY LOSSES
AMENITY NEEDSAMENITY PLANTING
AMENITY RIGHTAMENITY RIGHTS
AMENITY ROOMAMENITY STANDARDS
AMENITY USEAMENITY VALUE
AMENITY VALUE OF THE WATER COURSEAMENITY VALUE OF WATER COURSE
AMENIZARAMENMESSE
AMENMOSEAMENNYI
AMENNYIBENAMENNYIRE
AMENNYISZERAMENO
AMENOMINAKANUSHINOKAMIAMENOPHILY
AMENOPHISAMENOPHIS I
AMENOPHIS IIAMENOPHIS III
AMENOPHIS IVAMENOPHIS IV.: REGIERUNG UND DIE RAMESSIDENZEIT
AMENORREAAMENORREA APPARENTE
AMENORREA DA ALLATTAMENTOAMENORREA EMOZIONALE
AMENORREA IPOFISARIAAMENORREA OVARICA
AMENORREA PRIMARIAAMENORREA SECONDARIA
AMENORREA TRAUMATICAAMENORRHEA
AMENORRHEA AMENORRHOEAAMENORRHEAL
AMÉNORRHÉEAMÉNORRHÉE DE LACTATION
AMÉNORRHÉE ÉMOTIONNELLEAMÉNORRHÉE HYPOTHALAMIQUE
AMÉNORRHÉE OVARIENNEAMÉNORRHÉE PHYSIOLOGIQUE
AMÉNORRHÉE PITUITAIREAMÉNORRHÉE PSYCHOGÈNE
AMÉNORRHÉE TRAUMATIQUEAMÉNORRHÉE UTÉRINE
AMÉNORRHÉIQUEAMENORRHÖ
AMENORRHOEAMENORRHÖE
AMENORRHOEAAMENORRHOISCH
AMENOSOAMENRA
AMENRE HORNAKHTAMENS
AMENS AMANSQUE.AMENSAL
AMENSALEAMENSALISM
AMENSALISMEAMENSTRUAL OVULATION
AMENTAMENTA
AMENTACEEAMENTÁCEO
AMENTACEOUSAMENTAL
AMENTALESAMENTAR
AMENTATIOAMENTATUS
AMENTHESAMENTIA
AMENTIA ATTONITAAMENTIELL
AMENTIELLES SYNDROMAMENTIFÈRE
AMENTIFEROUSAMENTIFORME
AMENTIVE SPEECH CONFUSIONAMENTLFLORAE
AMENTOAMENTODURAL ANASTOMOSIS
AMENTULUMAMENTUM
AMENUDIARAMENUISEMENT
AMENUISERAMENY QEMAU
AMENZAMENZA
AMENZIALEAMER
AMER COMME L'ABSINTHEAMER D'INDIGO
AMER DE WELTERAMER GS
AMER.AMERADA GAUGE
AMERARAMERARSE
AMERASIANAMERASIATICO
AMÉRASIENAMÉRASIENNE
AMERBACHAMERBACH, JOHANN
AMERBACH, VEITAMERCE
AMERCEARAMERCEARSE
AMERCEDAMERCEMENT
AMERCEMENT ROYALAMERCEMENTS
AMERCENDEARSEAMERCER
AMERCESAMERCIAMENT
AMERCINGAMÈRE
AMEREKANIAMÈREMENT
AMERENGADOAMERIA
AMERIAN CONGRESO HOTEL BUENOS AIRES (BUENOS AIRES)AMERIAN PARK HOTEL CORDOBA (CORDOBA (AR))
AMERICAMERICA
AMERICĂAMÉRICA
AMÈRICAAMERICA (АМЕРИКА)
AMÉRICA CENTRALAMÉRICA DEL NORTE
AMÉRICA DEL SURAMERICA FIRSTER
AMERICA HOTEL BARCELONA (BARCELONA)AMERICA HOTEL LOURDES (LOURDES)
AMERICA HOTEL MALLORCA ISLAND (MALLORCA ISLAND)AMERICA LATINA
AMÉRICA LATINAAMÉRICA MERIDIONAL
AMERICA ON LINEAMERICA ONLINE
AMERICA SQUAREAMERICA STUDIOS HOTEL BUENOS AIRES (BUENOS AIRES)
AMERICA, PRECOLUMBIAN DISCOVERY OFAMERICA: NO PEACE BEYOND THE LINE
AMERICA'S COMMUNITY BANKERSAMERICA'S CUP
AMERICA'S DAIRY LANDAMERICA'S FUTURE TREES FOUNDATION
AMERICA'S HEALTH INSURANCE PLANSAMERICA'S MOST BEAUTIFUL CITY
AMERICA'S PARISAMERICAFIRSTER
AMÉRICAINAMERICAINE
AMÉRICAINEAMERICAN
AMERIČANAMERICAN (NATURAL) GAS ASSOCIATION
AMERICAN (STYLE) OPTIONAMERICAN [IMITATION] RUSSIA
AMERICAN ACADEMY OF ACTUARIESAMERICAN ACADEMY OF ACTUARIES AAA
AMERICAN ACADEMY OF ADVERTISINGAMERICAN ACADEMY OF ALLERGY
AMERICAN ACADEMY OF DRAMATIC ARTSAMERICAN ACADEMY OF ENVIRONMENTAL ENGINEERS
AMERICAN ACADEMY OF FINANCIAL MANAGEMENT AAFMAMERICAN ACCOUNT
AMERICAN ACCOUNT OF EVENTSAMERICAN ACCOUNTING ASSOCIATION
AMERICAN ACCOUNTING ASSOCIATION AAAAMERICAN ADVERTISING FEDERATION
AMERICAN AGENCY SYSTEMAMERICAN AIRLINES INC.
AMERICAN ALLIGATORAMERICAN ALOE
AMERICAN ANCHOVYAMERICAN AND ASIAN MOLE
AMERICAN ANTEATERSAMERICAN ANTHROPOLOGICAL ASSOCIATION
AMERICAN ANTITRUST INSTITUTEAMERICAN ANTLOVING CRICKET
AMERICAN APOLOGISTSAMERICAN APPAREL & FOOTWEAR ASSOCIATION
AMERICAN APPLEAMERICAN ARBITRATION ASSOCIATION
AMERICAN ARBORVITAEAMERICAN ARTICHOKE
AMERICAN AS APPLE PIEAMERICAN ASH
AMERICAN ASPENAMERICAN ASPEN BEETLE
AMERICAN ASSOCIATION FOR CANCER RESEARCHAMERICAN ASSOCIATION FOR CONSERVATION INFORMATION
AMERICAN ASSOCIATION FOR CONTAMINATION CONTROLAMERICAN ASSOCIATION FOR LABORATORY ACCREDITATION
AMERICAN ASSOCIATION FOR THE ADVANCEMENT OF SCIENCEAMERICAN ASSOCIATION FOR THE UNITED NATIONS
AMERICAN ASSOCIATION OF ADVERTISING AGENCIESAMERICAN ASSOCIATION OF ADVERTISING AGENTS
AMERICAN ASSOCIATION OF BLOOD BANKSAMERICAN ASSOCIATION OF EQUIPMENT LESSORS
AMERICAN ASSOCIATION OF EXPORTERS AND IMPORTERSAMERICAN ASSOCIATION OF HEALTH PLANS
AMERICAN ASSOCIATION OF IMMUNOLOGISTSAMERICAN ASSOCIATION OF INDIVIDUAL INVESTORS
AMERICAN ASSOCIATION OF INDIVIDUAL INVESTORS AAIIAMERICAN ASSOCIATION OF INSURANCE SERVICES
AMERICAN ASSOCIATION OF JURISTSAMERICAN ASSOCIATION OF MANAGING GENERAL AGENTS
AMERICAN ASSOCIATION OF OILWELL DRILLING CONTRACTORSAMERICAN ASSOCIATION OF PETROLEUM GEOLOGISTS
AMERICAN ASSOCIATION OF POLITICAL SCIENCEAMERICAN ASSOCIATION OF PUBLIC ACCOUNTANTS
AMERICAN ASSOCIATION OF PUBLIC OPINION RESEARCHAMERICAN ASSOCIATION OF REGISTERED PATENT ATTORNEYS AND AGENTS
AMERICAN ASSOCIATION OF RETIRED PERSONSAMERICAN ASSOCIATION OF SCIENTIFIC WORKERS
AMERICAN ASSOCIATION OF STATE SAVINGS AND LOAN SUPERVISORSAMERICAN ASSOCIATION OF TISSUE BANKS
AMERICAN ASSOCIATION OF UNIVERSITY INSTRUCTORS IN ACCOUNTINGAMERICAN ASSOCIATION OF UNIVERSITY PROFESSORS
AMERICAN AUTOMOBILE ASSOCIATIONAMERICAN AUTOMOBILE MANUFACTURERS ASSOCIATION
AMERICAN AVOCETAMERICAN BADGER
AMERICAN BALLET THEATREAMERICAN BANKER'S ASSOCIATION
AMERICAN BANKERS ASSOCIATIONAMERICAN BANKERS ASSOCIATION ABA
AMERICAN BANKERS ASSOCIATION (ABA)AMERICAN BANKERS' ASSOCIATION
AMERICAN BANKRUPTCY INSTITUTE ABIAMERICAN BAPTIST CHURCHES U.S.A.
AMERICAN BARAMERICAN BAR ASSOCIATION
AMERICAN BAR ASSOCIATION (ABA)AMERICAN BASEMENT
AMERICAN BASSWOODAMERICAN BEACH GRASS
AMERICAN BEAUTYAMERICAN BEAVER
AMERICAN BEECHAMERICAN BIRCH
AMERICAN BISONAMERICAN BITTERN
AMERICAN BITTERSWEETAMERICAN BLACK BEAR
AMERICAN BLACK CURRANTAMERICAN BLACK FLOUR BEETLE
AMERICAN BOARD OF COMMISSIONERS FOR FOREIGN MISSIONSAMERICAN BOLLWORM
AMERICAN BONDAMERICAN BOOK AWARDS
AMERICAN BRIGGS STANDARD STRAIGHT THREADAMERICAN BRIGGS STRAIGHT THREAD
AMERICAN BROADCASTING COMPANIESAMERICAN BROADCASTING COMPANY
AMERICAN BROADCASTING CORPORATIONAMERICAN BROOK LAMPREY
AMERICAN BROWN MOUSEAMERICAN BUREAU OF METAL STATISTICS
AMERICAN BUREAU OF SHIPPINGAMERICAN BUREAU OF STANDARDS
AMERICAN BURROWING SKINKAMERICAN BUSINESS CENTER
AMERICAN BUSINESS COMMUNICATION ASSOCIATIONAMERICAN BUSINESS PRESS, INC.
AMERICAN CAISSONAMERICAN CALLABLE BOND
AMERICAN CANE RATAMERICAN CAPITALISM: THE CONCEPT OF COUNTERVAILING POWER
AMERICAN CARROTAMERICAN CAVIAR
AMERICAN CEDARAMERICAN CHAMBER OF COMMERCE
AMERICAN CHAMBER OF COMMERCE IN JAPANAMERICAN CHAMELEON
AMERICAN CHEESEAMERICAN CHEMICAL SOCIETY
AMERICAN CHERRYAMERICAN CHESTNUT
AMERICAN CHURCH, THEAMERICAN CITIZEN
AMERICAN CIVIL LIBERTIES UNIONAMERICAN CLAUSE
AMERICAN CLEAN ENERGY AND SECURITY ACT OF 2009AMERICAN CLOTH
AMERICAN COCKROACHAMERICAN CODE FOR INFORMATION INTERCHANGE ASCII
AMERICAN COLLEGEAMERICAN COLLEGE AT LOUVAIN, THE
AMERICAN COLLEGE IN ROME, THEAMERICAN COLLEGE IN ROME, THE SOUTH
AMERICAN COLLEGE OF LIFE UNDERWRITERSAMERICAN COLONY HOTEL JERUSALEM (JERUSALEM)
AMERICAN COLUMBINEAMERICAN COMMITTEE FOR INTERNATIONAL WILDLIFE PROTECTION
AMERICAN COMMUNICATION ASSOCIATIONAMERICAN CONCRETE INSTITUTE
AMERICAN CONFERENCE OF GOVERNMENTAL INDUSTRIAL HYGIENISTSAMERICAN CONQUEST: DIVIDED NATION
AMERICAN COOTAMERICAN COPPER
AMERICAN CORNELIAN TREEAMERICAN COTTON
AMERICAN COUNCIL OF LEARNED SOCIETIESAMERICAN COUNCIL OF LIFE INSURANCE
AMERICAN COUNCIL OF LIFE INSURERSAMERICAN COUNCIL ON EDUCATION
AMERICAN COURT OF HUMAN RIGHTSAMERICAN CRAB
AMERICAN CRANBERRYAMERICAN CRESS
AMERICAN CROCODILEAMERICAN CROW
AMERICAN CURRENCY QUOTATIONAMERICAN CUSTOMER SATISFACTION INDEX
AMERICAN CUSTOMER SATISFACTION INDEX ACSIAMERICAN CUT
AMERICAN DABAMERICAN DAGGER
AMERICAN DAGGERMOTHAMERICAN DECISIONS
AMERICAN DEERAMERICAN DEPOSITARY RECEIPT
AMERICAN DEPOSITARY RECEIPT ADRAMERICAN DEPOSITARY RECEIPT (ADR)
AMERICAN DEPOSITARY RECEIPT FEESAMERICAN DEPOSITARY RECEIPT HOLDER
AMERICAN DEPOSITARY RECEIPT RATIOAMERICAN DEPOSITARY RECEIPTS
AMERICAN DEPOSITARY RECEIPTS PROGRAMAMERICAN DEPOSITARY SHARE
AMERICAN DEPOSITARY SHARE ADSAMERICAN DEPOSITORY RECEIPT
AMERICAN DEPOSITORY RECEIPTSAMERICAN DEPOSITORY RECEIPTS (ADRS)
AMERICAN DEPOSITORY SHAREAMERICAN DIECASTING INSTITUTE
AMERICAN DIPPERAMERICAN DOG TICK
AMERICAN DOGWOODAMERICAN DREAM
AMERICAN EAGLEAMERICAN EAGLE\(S\)
AMERICAN ECHOCARDIOGRAPH RESEARCH IMAGING SYSTEMAMERICAN ECONOMIC ASSOCIATION
AMERICAN ECONOMIC REVIEWAMERICAN ECONOMICS ASSOCIATION
AMERICAN EELAMERICAN EGRET
AMERICAN ELDERAMERICAN ELECTRIC POWER
AMERICAN ELECTROCHEMICAL SOCIETYAMERICAN ELK
AMERICAN ELMAMERICAN EMPIRE
AMERICAN ENGINEERING STANDARDS COMMITMENTAMERICAN ENGINEERING STANDARDS COMMITTEE
AMERICAN ENGLISHAMERICAN EPHEMERIS AND NAUTICAL ALMANAC
AMERICAN EUGENICS SOCIETYAMERICAN EXCHANGE
AMERICAN EXPERIENCE TABLEAMERICAN EXPERIENCE TABLE OF MORTALITY
AMERICAN EXPRESSAMERICAN EXPRESS \(CARD\)
AMERICAN EXPRESS CARDAMERICAN EXPRESS COMPANY
AMERICAN EXPRESS, AMEX, АМЕРИКАН ЭКСПРЕССAMERICAN FARM BUREAU FEDERATION
AMERICAN FEDERATION OF CATHOLIC SOCIETIESAMERICAN FEDERATION OF LABOR
AMERICAN FEDERATION OF LABOR — CONGRESS OF INDUSTRIAL ORGANIZATIONSAMERICAN FEDERATION OF LABOR AND CONGRESS OF INDUSTRIAL ORGANIZATIONS
AMERICAN FEDERATION OF LABOURAMERICAN FEDERATION OF TEACHERS
AMERICAN FILM INSTITUTEAMERICAN FILMS TOOK OVER THE SCREEN
AMERICAN FINFOOTAMERICAN FISHERIES SOCIETY
AMERICAN FLAMINGOAMERICAN FLYING SQUIRREL
AMERICAN FOOTBALLAMERICAN FOOTBALL: URSPRUNG UND REGELN DES AMERIKANISCHEN NATIONALSPORTS
AMERICAN FORCES INFORMATION SERVICEAMERICAN FORCES NETWORK EUROPE
AMERICAN FOREIGN INSURANCE ASSOCIATIONAMERICAN FOREST INSTITUTE
AMERICAN FORESTRY ASSOCIATIONAMERICAN FOUNDRYMEN'S ASSOCIATION
AMERICAN FOURSQUAREAMERICAN GAS ASSOCIATION
AMERICAN GAS ASSOCIATION:AMERICAN GEAR MANUFACTURERS ASSOCIATION
AMERICAN GENERALAMERICAN GEOGRAPHICAL SOCIETY
AMERICAN GEOLOGICAL INSTITUTEAMERICAN GEOPHYSICAL UNION
AMERICAN GERMANDERAMERICAN GINSENG
AMERICAN GLOBEFLOWERAMERICAN GOLDENEYE
AMERICAN GOLDFINCHAMERICAN GOODS RETURNED
AMERICAN GOOSEFISHAMERICAN GRAPE
AMERICAN GRASS THRIPSAMERICAN GRASSHOPPER
AMERICAN GROUP OF INTERNATIONAL PATENT AND TRADEMARK ASSOCIATIONAMERICAN HARDNESS
AMERICAN HARVEST MOUSEAMERICAN HAZEL
AMERICAN HELLEBOREAMERICAN HOLLY
AMERICAN HOLLY LEAF MINERAMERICAN HOOKWORM
AMERICAN HORNBEAMAMERICAN HOSPITAL ASSOCIATION
AMERICAN HOTEL NAPLES (NAPLES)AMERICAN HULL FORM
AMERICAN HULL INSURANCE SYNDICATEAMERICAN IMMUNIZATION PRACTICES ADVISORY COMMITTEE
AMERICAN IMPORTED FIRE ANTAMERICAN INDIAN
AMERICAN INDIAN LAWAMERICAN INDIAN MOVEMENT
AMERICAN INDIANSAMERICAN INDUSTRIAL HYGIENE ASSOCIATION
AMERICAN INDUSTRIAL RADIUM AND XRAY SOCIETYAMERICAN INSTITUTE FOR CHARTERED PROPERTY CASUALTY UNDERWRITERS
AMERICAN INSTITUTE FOR CPCUAMERICAN INSTITUTE IN TAIWAN
AMERICAN INSTITUTE OF ACCOUNTANTSAMERICAN INSTITUTE OF AERONAUTICS AND ASTRONAUTICS
AMERICAN INSTITUTE OF BANKERSAMERICAN INSTITUTE OF BANKING
AMERICAN INSTITUTE OF BANKING AIBAMERICAN INSTITUTE OF BIOLOGICAL SCIENCES
AMERICAN INSTITUTE OF CERTIFIED PUBLIC ACCOUNTANTSAMERICAN INSTITUTE OF CERTIFIED PUBLIC ACCOUNTANTS AICPA
AMERICAN INSTITUTE OF CHEMICAL ENGINEERSAMERICAN INSTITUTE OF CHEMISTS
AMERICAN INSTITUTE OF COOPERATIONAMERICAN INSTITUTE OF ELECTRICAL ENGINEERS
AMERICAN INSTITUTE OF MARINE UNDERWRITERSAMERICAN INSTITUTE OF MINING AND METALLURGICAL ENGINEERS
AMERICAN INSTITUTE OF MINING ENGINEERINGAMERICAN INSTITUTE OF MINING ENGINEERS
AMERICAN INSTITUTE OF MINING, METALLURGICAL AND PETROLEUM ENGINEERSAMERICAN INSTITUTE OF PHYSICS
AMERICAN INSTITUTE OF PUBLIC OPINIONAMERICAN INSTITUTE OF RADIO ENGINEERS
AMERICAN INSTITUTE OF STEEL AND IRONAMERICAN INSTITUTE OF STEEL CONSTRUCTION
AMERICAN INSTITUTIONALISMAMERICAN INSURANCE ASSOCIATION
AMERICAN INSURANCE ASSOCIATION AIAAMERICAN INTELLECTUAL PROPERTY LAW ASSOCIATION
AMERICAN INTERESTAMERICAN INTERESTS
AMERICAN INTERNATIONAL GROUPAMERICAN INTERNATIONAL LAW
AMERICAN INTERNATIONAL SCHOOLAMERICAN INVENTORS PROTECTION ACT
AMERICAN IPECACAMERICAN IVY
AMERICAN JACANAAMERICAN JACKAL
AMERICAN JAPANESEAMERICAN JEWISH CONGRESS
AMERICAN JOBS CREATION ACT OF 2004AMERICAN JOURNAL OF COMMUNITY PSYCHOLOGY
AMERICAN JUDICATURE SOCIETYAMERICAN JUMPING MOUSE
AMERICAN KESTRELAMERICAN KINOPLASM
AMERICAN KINOROOTAMERICAN KNOT
AMERICAN KURDISH INFORMATION NETWORKAMERICAN LABOR PARTY
AMERICAN LABORATORY THEATREAMERICAN LAND TITLE ASSOCIATION
AMERICAN LAND TITLE ASSOCIATION ALTAAMERICAN LANGUAGE
AMERICAN LAPPET CATERPILLARAMERICAN LARCH
AMERICAN LAURELAMERICAN LAW INSTITUTE
AMERICAN LEAF FISHAMERICAN LEATHER
AMERICAN LEGIONAMERICAN LEISHMANIASIS
AMERICAN LEOPARDAMERICAN LETTER
AMERICAN LIBERALISMAMERICAN LICORICE
AMERICAN LIGHT DISTRIBUTION SYSTEMAMERICAN LION
AMERICAN LITTORAL SOCIETYAMERICAN LLOYD'S
AMERICAN LOANAMERICAN LONGSTAPLE COTTON
AMERICAN LOOKAMERICAN LOTUS
AMERICAN MACHINEAMERICAN MAGPIE
AMERICAN MAIDENHAIRAMERICAN MALLEABLE (CAST) IRON
AMERICAN MALLEABLE CAST IRONAMERICAN MALLEABLE IRON
AMERICAN MANAGEMENT ASSOCIATIONAMERICAN MANATEE
AMERICAN MANDRAKE AND HALLUCINATIONSAMERICAN MARKETING ASSOCIATION
AMERICAN MARTENAMERICAN MCGEE'S ALICE
AMERICAN MEASURING TOOL MANUFACTURERS ASSOCIATIONAMERICAN MEDICAL ASSOCIATION
AMERICAN MEDITATION SOCIETYAMERICAN MEGATRENDS INC.
AMERICAN MENTALITYAMERICAN MERGANSER
AMERICAN MESONAMERICAN METHOD
AMERICAN MICROSYSTEMS, INC.AMERICAN MINK
AMERICAN MOBILE SATELLITE CORPORATIONAMERICAN MOON MOTH
AMERICAN MOUNTAIN LIONAMERICAN MULBERRY
AMERICAN MUNICIPAL BOND ASSURANCE CORPORATIONAMERICAN NATIONAL PIPE THREAD
AMERICAN NATIONAL SCREW THREADAMERICAN NATIONAL STANDARD
AMERICAN NATIONAL STANDARD THREADAMERICAN NATIONAL STANDARDS INSTITUTE
AMERICAN NATIONAL STANDARDS INSTITUTE ANSIAMERICAN NATIONAL STANDARDS INSTITUTE АМЕРИКАНСКИЙ НАЦИОНАЛЬНЫЙ ИНСТИТУТ СТАНДАРТОВ
AMERICAN NATURAL GAS ASSOCIATIONAMERICAN NATURE STUDY SOCIETY
AMERICAN NAZI PARTYAMERICAN NEWSPAPER GUILD
AMERICAN NEWSPAPER PUBLISHERS ASSOCIATIONAMERICAN NIGHTSHADE
AMERICAN OAKAMERICAN OCEAN POUT
AMERICAN OF CHINESE EXTRACTIONAMERICAN OF JAPANESE DESCENT
AMERICAN OIL COMPANIES MATERIALS ASSOCIATIONAMERICAN OIL PALM
AMERICAN OPOSSUMAMERICAN OPPORTUNITY TAX CREDIT
AMERICAN OPTIONAMERICAN ORGAN
AMERICAN ORNITHOLOGISTS' UNIONAMERICAN OSTRICH
AMERICAN OUTLAWS (2001)AMERICAN OWNED
AMERICAN OYSTER CATCHERAMERICAN PAINTED LADY
AMERICAN PANIC GRASSAMERICAN PARAFFIN OIL
AMERICAN PARITYAMERICAN PATENT
AMERICAN PATENT LAW ASSOCIATIONAMERICAN PECTORAL SANDPIPER
AMERICAN PETROLEUM INDUSTRIES COMMITMENTAMERICAN PETROLEUM INDUSTRIES COMMITTEE
AMERICAN PETROLEUM INSTITUTEAMERICAN PETROLEUM INSTITUTE (API)
AMERICAN PETROLEUM INSTITUTE COMMITMENTAMERICAN PETROLEUM INSTITUTE COMMITTEE
AMERICAN PETROLEUM SOCIETYAMERICAN PHYSICAL SOCIETY
AMERICAN PINE SHOOT MOTHAMERICAN PIPE THREAD
AMERICAN PIPITAMERICAN PLAN
AMERICAN PLANEAMERICAN PLANE TREE
AMERICAN PLUM BORERAMERICAN POLITICAL SCIENCE ASSOCIATION
AMERICAN POLLACKAMERICAN POND TURTLE
AMERICAN POPLARAMERICAN PORCUPINE
AMERICAN POTTOAMERICAN POWER CO. V. SEC
AMERICAN PROTECTIVE ASSOCIATION, THEAMERICAN PSYCHIATRIC ASSOCIATION'S DEFINITION OF HALLUCINATIONS
AMERICAN PSYCHOLOGICAL ASSOCIATIONAMERICAN PSYCHOLOGICAL ASSOCIATION'S DEFINITION OF HALLUCINATIONS
AMERICAN PUBLIC HEALTH ASSOCIATIONAMERICAN PULSER
AMERICAN PUMPAMERICAN PURPLE GALLINULE
AMERICAN PYGMY MOUSEAMERICAN PYGMY SQUIRREL
AMERICAN RADIO ASSOCIATIONAMERICAN RADIOTELEGRAPHISTS ASSOCIATION
AMERICAN RAILWAY ASSOCIATIONAMERICAN RATE
AMERICAN RECOVERY AND REINVESTMENT ACTAMERICAN RED CROSS
AMERICAN RED RASPBERRYAMERICAN RED SQUIRREL
AMERICAN REDSTARTAMERICAN REFERENCE VOLUME
AMERICAN REFRACTORIES INSTITUTEAMERICAN REINSURANCE ASSOCIATION
AMERICAN RESEARCH BUREAUAMERICAN REVISED VERSION
AMERICAN REVOLUTIONAMERICAN RHEUMATISM ASSOCIATION
AMERICAN RISK AND INSURANCE ASSOCIATIONAMERICAN ROBIN
AMERICAN ROSE SAWFLYAMERICAN ROSE SLUG SAWFLY
AMERICAN ROUGHWINGED SWALLOWAMERICAN RULE
AMERICAN RUSSIAAMERICAN SABLE
AMERICAN SADDLE HORSEAMERICAN SALVAGE POOL ASSOCIATION
AMERICAN SAMOAAMERICAN SANICLE
AMERICAN SARDINEAMERICAN SARSAPARILLA
AMERICAN SAWFLYAMERICAN SCREW THREAD
AMERICAN SEED BEETLEAMERICAN SELLING PRICE
AMERICAN SHARE INSURANCEAMERICAN SHARES
AMERICAN SHARES AMSTERDAM SYSTEMAMERICAN SHORE
AMERICAN SHORE AND BEACH PRESERVATION ASSOCIATIONAMERICAN SHORTTAILED SHREW
AMERICAN SHREW MOLEAMERICAN SHREWMOLE
AMERICAN SMALL COPPERAMERICAN SMELT
AMERICAN SOCIAL SCIENCE ASSOCIATIONAMERICAN SOCIETY
AMERICAN SOCIETY FOR HISTOCOMPATIBILITY AND IMMUNOGENETICSAMERICAN SOCIETY FOR IMMUNOLOGY
AMERICAN SOCIETY FOR METALSAMERICAN SOCIETY FOR MICROBIOLOGY
AMERICAN SOCIETY FOR NONDESTRUCTIVE TESTINGAMERICAN SOCIETY FOR PUBLIC ADMINISTRATION
AMERICAN SOCIETY FOR QUALITYAMERICAN SOCIETY FOR QUALITY CONTROL
AMERICAN SOCIETY FOR TESTING AND MATERIALSAMERICAN SOCIETY FOR TESTING MATERIALS
AMERICAN SOCIETY OF ADVERTISING AND PROMOTIONAMERICAN SOCIETY OF APPRAISERS
AMERICAN SOCIETY OF BIOCHEMISTSAMERICAN SOCIETY OF BIOLOGICAL CHEMISTS
AMERICAN SOCIETY OF CERTIFIED PUBLIC ACCOUNTANTSAMERICAN SOCIETY OF CIVIL ENGINEERS
AMERICAN SOCIETY OF HEATING, REFRIGERATION AND AIR CONDITIONINGAMERICAN SOCIETY OF HOME INSPECTORS
AMERICAN SOCIETY OF INSURANCE MANAGEMENTAMERICAN SOCIETY OF LIMNOLOGY AND OCEANOGRAPHY
AMERICAN SOCIETY OF LUBRICATION ENGINEERSAMERICAN SOCIETY OF MAGAZINE EDITORS
AMERICAN SOCIETY OF MECHANICAL ENGINEERSAMERICAN SOCIETY OF PARASITOLOGISTS
AMERICAN SOCIETY OF PENSION ACTUARIESAMERICAN SOCIETY OF PENSION PROFESSIONALS & ACTUARIES
AMERICAN SOCIETY OF PENSION PROFESSIONALS AND ACTUARIESAMERICAN SOCIETY OF PHOTOGRAMMETRY
AMERICAN SOCIETY OF PROFESSIONAL GEOLOGISTSAMERICAN SOCIETY OF PUBLIC HEALTH
AMERICAN SOCIETY OF RANGE MANAGEMENTAMERICAN SOCIETY OF SAFETY ENGINEERS
AMERICAN SOCIETY OF SANITARY ENGINEERINGAMERICAN SOCIETY OF TRANSPLANT SURGEONS
AMERICAN SOCIETY OF WOMAN ACCOUNTANTSAMERICAN SOCIETY OF WOMEN ACCOUNTANTS ASWA
AMERICAN SOCIETY OF ZOOLOGISTAMERICAN SOCIETY OF ZOOLOGISTS
AMERICAN SOCIOLOGICAL ASSOCIATIONAMERICAN SOCIOLOGICAL REVIEW
AMERICAN SOFTWARE ASSOCIATIONAMERICAN SOLDIER FLY
AMERICAN SOLEAMERICAN SPANISH
AMERICAN SPARROW HAWKAMERICAN SPARROWS
AMERICAN SPONSORED REGIMEAMERICAN SPY SATELLITE
AMERICAN STANDARDAMERICAN STANDARD ASSOCIATION
AMERICAN STANDARD BEAMAMERICAN STANDARD BUTTRESS THREAD
AMERICAN STANDARD CABLE SYSTEMAMERICAN STANDARD CABLE SYSTEM OF DRILLING
AMERICAN STANDARD CODE FOR INFORMATION INTERCHANGEAMERICAN STANDARD INTERNAL STRAIGHT PIPE THREAD
AMERICAN STANDARD PIPE LOCKNUT THREADAMERICAN STANDARD PIPE THREAD
AMERICAN STANDARD STRAIGHT PIPE COUPLING THREADAMERICAN STANDARD STRAIGHT PIPE THREAD
AMERICAN STANDARD TAPER PIPE THREADAMERICAN STANDARD THREAD
AMERICAN STANDARD VERSIONAMERICAN STANDARDS ASSOCIATION
AMERICAN STANDARDS ASSOCIATION:AMERICAN STATISTICAL ASSOCIATION
AMERICAN STINTAMERICAN STOCK EXCHANGE
AMERICAN STOCK EXCHANGE AMEXAMERICAN STOCK EXCHANGE (AMEX)
AMERICAN STOCK EXCHANGE MAJOR MARKET INDEXAMERICAN STOCK EXCHANGE MARKET VALUE INDEX
AMERICAN STRAIGHT PIPE COUPLING THREADAMERICAN STRAIGHT PIPE THREAD
AMERICAN STUDIESAMERICAN STYLE COVERED WARRANT
AMERICAN STYLE OPTIONAMERICAN SUMAC
AMERICAN SUMACHAMERICAN SUPPLIER INSTITUTE
AMERICAN SYCAMOREAMERICAN SYSTEM
AMERICAN SYSTEM OF DRILLINGAMERICAN TAPER PIPE THREAD
AMERICAN TAXATION ASSOCIATIONAMERICAN TELEPHONE & TELEGRAPH CO.
AMERICAN TELEPHONE AND TELEGRAPH COMPANYAMERICAN TELEVISION AND RADIO COMMERCIALS FESTIVAL
AMERICAN TENT CATERPILLARAMERICAN TERMS
AMERICAN TERMSNAMERICAN TIGER
AMERICAN TISSUE TYPE COLLECTIONAMERICAN TON
AMERICAN TOPKNOTAMERICAN TREE
AMERICAN TROTTERAMERICAN TRUCKING ASSOCIATION
AMERICAN TRYPANOSOMIASISAMERICAN TUBESNOUT
AMERICAN TURBOTAMERICAN TWANG
AMERICAN TYPE CULTURE COLLECTIONAMERICAN UMBRELLA
AMERICAN UNIVERSITY IN BULGARIAAMERICAN VALERIAN
AMERICAN VERMILLIONAMERICAN VERVAIN
AMERICAN VETCHAMERICAN VETERANS
AMERICAN VIRGIN ISLANDSAMERICAN VITICULTURAL AREA
AMERICAN VULTURESAMERICAN WAINSCOT
AMERICAN WALNUTAMERICAN WAR FOR INDEPENDENCE
AMERICAN WAR OF INDEPENDENCEAMERICAN WATER RESOURCES ASSOCIATION
AMERICAN WATER WORKS ASSOCIATIONAMERICAN WATER WORKS ASSOCIATION RESEARCH FOUNDATION
AMERICAN WAY OF LIFEAMERICAN WELDING SOCIETY
AMERICAN WHITE BIRCHAMERICAN WHITE PELICAN
AMERICAN WHITEFRONTED GOOSEAMERICAN WIGEON
AMERICAN WILLOW LEAF BEETLEAMERICAN WINE
AMERICAN WIRE CAGEAMERICAN WIRE GAGE
AMERICAN WIRE GAUGEAMERICAN WOMEN'S ECONOMIC DEVELOPMENT CORPORATION
AMERICAN WOMEN'S SOCIETY OF CERTIFIED PUBLIC ACCOUNTANTSAMERICAN WOMEN'S SOCIETY OF CERTIFIED PUBLIC ACCOUNTANTS AWSCPA
AMERICAN WOOD ANEMONEAMERICAN WOOD STRAWBERRY
AMERICAN WOODCOCKAMERICAN WORM SEED OIL
AMERICAN YEWAMERICAN YOGA ASSOCIATION
AMERICAN ZINC INSTITUTEAMERICAN-STYLE OPTION
AMERICAN180AMERICANA
AMERICANA HOTEL LONDON (LONDON)AMERICANATA
AMERICANBACKEDAMERICANBRITISHCANADIAN STANDARD
AMERIČANÉAMERIČANÉ JSOU ZMATENI
AMERIČANÉ NAZÝVAJÍAMERIČANÉ POCHOPILI
AMERIČANÉ POJMENOVALI VĚCÍAMERIČANÉ SI ROZHODLI
AMERIČANÉ VŠAK POKLÁDAJÍAMERIČANÉ VŽDY
AMERICĂNESCAMERICANESE
AMERICĂNEŞTEAMERICANFLAGGED SHIP
AMERICANFORM TYPE SHARE CERTIFICATEAMERICANFRENCH
AMERIČANI POHROZILIAMERICANINDIAN STUDIES
AMERICANISATIONAMÉRICANISATION
AMERICANISEAMÉRICANISER
AMERICANISMAMÉRICANISME
AMERICANISMOAMERICANIST
AMERICANISTAAMÉRICANISTE
AMERICANISTICAAMERICANIZA
AMERICANIZACIÓNAMERICANIZAR
AMERICANIZARSEAMERICANIZATION
AMERICANIZEAMERICANIZED
AMERICANIZESAMERICANIZING
AMERICANIZZAREAMERICANIZZARSI
AMERIČANKAAMERICANLED
AMERICANLED COALITIONAMERICANLED EMBARGO
AMERICANLYAMERICANMADE WEAPONS
AMERICANMEDIATED PEACE PLANAMERICANO
AMERICANO HOTEL ARICA (ARICA)AMERICANO RESIDENCIAL LISBON (LISBON)
AMERICANOCRACYAMERICANOLOGIST
AMERICANOLOGYAMERICANOPHILE
AMERICANOPHILIAAMERICANOPHOBE
AMERICANOPHOBIAAMERICANRUN
AMERICANSAMERICANS AANDELEN AMSTERDAMSE USANCE
AMERICANS WITH DISABILITIES ACTAMERICANS WITH DISABILITIES ACT ADA
AMERICANS WITH DISABILITIES ACT AMENDMENTS ACT OF 2008 €“ ADAAAAMERICANSTYLE
AMERICANSTYLE COVERED WARRANTAMERICANSTYLE OPTION
AMERICANSTYLE WARRANTAMERICANSUPPLIED WEAPONS
AMERIČANŮ (2.P. MN.Č.)AMERICANUM
AMERIČANŮM NABÍDLIAMERICAS
AMERICAS BEST INN & SUITES SALT LAKE CITY (SALT LAKE CITY/PARK CITY)AMERICAS BEST VALUE INN & SUITES LAS VEGAS (LAS VEGAS)
AMERICAS TOWERS HOTEL BUENOS AIRES (BUENOS AIRES)AMERICAS' CENTRAL SECURITIES DEPOSITORIES ASSOCIATION
AMERICE (3.P.)AMERICENTRISM
AMERICINN BROOKLYN CENTER MINNEAPOLIS (MINNEAPOLIS/ST.PAUL)AMERICINN CHANHASSEN MINNEAPOLIS (MINNEAPOLIS/ST.PAUL)
AMERICINN CHICAGO/BOLINGBROOK (CHICAGO)AMERICINN GERMANTOWN MILWAUKEE (MILWAUKEE)
AMERICINN HOTEL & SUITES SARASOTA (SARASOTA / BRADENTON)AMERICIO
AMERICIUMAMÉRICIUM
AMERICKÁAMERICKÁ AUTA
AMERICKÁ EKONOMIKAAMERICKÁ HNILOBA PLODU
AMERICKÁ HODNOCENÍAMERICKÁ VYNALÉZAVOST
AMERICKÉAMERICKÉ ADMINISTRACE
AMERICKÉ DIPLOMACIEAMERICKÉ EKONOMIKY
AMERICKÉ FILIÁLKY KONCERNUAMERICKÉ FONDOVÉ INDEXY
AMERICKÉ KNIHOVNYAMERICKÉ POBOČCE
AMERICKÉ SPOLEČNOSTIAMERICKÉ ÚŘADY
AMERICKÉHOAMERICKÉHO BÍLÉHO DOMU
AMERICKÉHO FORMÁTUAMERICKÉHO NEBO BRITSKÉHO VOJENSKÉHO LETECTVÍ
AMERICKÉHO ODVĚTVÍAMERICKÉHO PARTNERA
AMERICKÉHO STŘEDNÍHO ÚTOČNÍKA HOSTŮAMERICKÉHO VĚDCE
AMERICKÉHO VELVYSLANECTVÍ V PRAZEAMERICKÉMU PREZIDENTOVI
AMERICKORUSKÉAMERICKOU FIRMOU
AMERICKOU VYNALÉZAVOSTÍAMERICKÝ
AMERICKÝ FILMOVÝ REŽISÉRAMERICKÝ VĚDEC
AMERICKÝCHAMERICKÝCH AMBASÁD
AMERICKÝCH DEPOZITNÍCH DLUHOPISŮAMERICKÝCH DOMÁCNOSTÍ
AMERICKÝCH NÁVRHŮAMERICKÝCH VYZNAMENÁNÍ
AMERICKÝM FIRMÁMAMERICKÝM STÍHAČKÁM
AMÉRICOMERIDIONALAMERICORPS
AMÉRICOSETENTRIONALAMÉRIDIANISME
AMERIGHIAMERIGO
AMERIGO VESPUCCIAMERIHOST INN AND SUITES (WHITEWATER)
AMERIHOST RESORT MAINGATE (ORLANDO/KISSIMMEE)AMERIKA
AMERÍKAAMERIKA (FRAUEN)
AMERIKA (GEOGRAPHIE)AMERIKA (GESCHICHTE)
AMERIKA ALS IDEE: GOD'S OWN COUNTRYAMERIKA DEN AMERIKANERN
AMERIKA MAŘÍ NAŠEAMERIKA, DU HAST ES BESSER
AMERIKAANAMERIKAANS
AMERIKAANSEAMERIKABÅT
AMERIKADEUTSCHEAMERIKADEUTSCHER
AMERIKAELLENESAMERIKAELLENESSÉG
AMERIKAFARERAMERIKAFEBER
AMERIKAGEDENKBIBLIOTHEKAMERIKAHAUS
AMERIKAHÄUSERAMERIKAHÖRIG
AMERIKAIAMERIKAI EGYESÜLT ALLAMOK
AMERIKAI NÖAMERIKAIAS
AMERIKAKUTATÁSAMERIKALI
AMERIKALI'AMERIKALI\ ERKEK
AMERIKANAMERIKAN -EN -ER
AMERIKAN BARAMERIKAN PAZARI
AMERIKAN YHDYSVALLAT ( USA)AMERIKANA
AMERIKANAREAMERIKANCA
AMERIKANEBELAMERIKANER
AMERIKÁNERAMERIKANERGRÜN
AMERIKANERINAMERIKANERINNE
AMERIKANERNAMERIKANERREBE
AMERIKANERREBENAMERIKANERWAGEN
AMERIKANIAMERIKANISCH
AMERIKANISCHEAMERIKANISCHE BAUWEISE
AMERIKANISCHE HAUTLEISCHMANIOSEAMERIKANISCHE KUNST
AMERIKANISCHE LITERATURAMERIKANISCHE MUSIK
AMERIKANISCHE NATION UND KULTURAMERIKANISCHE NUSS
AMERIKANISCHE ORGELAMERIKANISCHE PARTEI
AMERIKANISCHE PHILOSOPHIEAMERIKANISCHE PHYTOLACCA
AMERIKANISCHE REVOLUTIONAMERIKANISCHE REVOLUTION \(1776 BIS 1783\): DAS STREBEN NACH GLÜCK
AMERIKANISCHE ROTEICHEAMERIKANISCHE TERPENTINKIEFER
AMERIKANISCHE TRAGÖDIE, EINEAMERIKANISCHE TRAUM, DER
AMERIKANISCHE UNABHÄNGIGKEITSERKLÄRUNGAMERIKANISCHE VERFASSUNG
AMERIKANISCHE WAGENAMERIKANISCHE WEINE
AMERIKANISCHE ZECKENRICKETTSIOSEAMERIKANISCHER BÜRGERKRIEG
AMERIKANISCHER FAULBAUMAMERIKANISCHER GARTENKULTIVATOR
AMERIKANISCHER HANFAMERIKANISCHER SCHNEEBALL
AMERIKANISCHES ABBLENDLICHTAMERIKANISCHES DUELL
AMERIKANISCHES ENGLISCHAMERIKANISCHES FIEBER
AMERIKANISCHES FUßBLATTAMERIKANISCHES MITTELMEER
AMERIKANISCHES SCHEINWERFERSYSTEMAMERIKANISCHES WURMKRAUT
AMERIKANISCHES ZECKENFIEBERAMERIKANISCHSAMOA
AMERIKANISCHSPANISCHER KRIEGAMERIKANISERE
AMERIKANISIERENAMERIKANISIERUNG
AMERIKANISMEAMERIKANISMEN
AMERIKANISMUSAMERIKANIST
AMERIKANISTAAMERIKANISTIK
AMERIKANISTINAMERIKANISTISCH
AMERIKANISZTIKAAMERIKANITE
AMERIKANIZÁLAMERIKANIZÁLÁS
AMERIKANIZÁLÓDÁSAMERIKANIZÁLÓDIK
AMERIKANIZITÄTAMERIKANIZMUS
AMERIKANLIAMERIKANSK
AMERIKANSK OLJEAMERIKÁNUS
AMERIKÁSAMERIKAS ENTDECKUNG UND ERSTE WELTUMSEGLUNG: DIE ERDE IST RUND
AMERIKÁZÁSAMERIKÁZIK
AMERIKÁZNIAMERIKI
AMERIKIETĖAMERIKIETIS
AMERIKKAAMERIKKALAINEN
AMERIKOU (7.P.)AMERÍKUMAÐUR
AMERIMNONAMERIND
AMERINDIANAMERINDIANO
AMERINDICAMÉRINDIEN
AMÉRINDIENNEAMERINDIO
AMERÍNDIOAMERINDO
AMERINUSAMERIOLA
AMÉRIQUEAMÉRIQUE CENTRALE
AMÉRIQUE DU NORDAMÉRIQUE DU SUD
AMÉRIQUE LATINEAMÉRISANT
AMERÍSKURAMERISM
AMERISMOAMERISSAGEM
AMERISSARAMERISTIC
AMERISUITES BOSTON MEDFORD (BOSTON)AMERISUITES CHICAGO SCHAUMBURG (CHICAGO)
AMERISUITES ATLANTA DOWNTOWN (ATLANTA)AMERISUITES AUSTIN AIRPORT (AUSTIN)
AMERISUITES AUSTIN ARBORETUM (AUSTIN)AMERISUITES MINNEAPOLIS MALL OF AMERICA (MINNEAPOLIS/ST.PAUL)
AMERISUITES ONTARIO MILLS / LOS ANGELES (ONTARIO)AMERISUITES TEMPE ARIZONA MILLS (PHOENIX)
AMERITADOAMERITAR
AMERITEL INN BOISE TOWNE SQUARE (BOISE)AMERIZA
AMERIZAJAMERIZARE
AMERIZIUMAMERLING
AMERLING FRIEDRICH VONAMERLO
AMERLOCKAMERLOQUE
AMERLOTAMERO
AMEROSPORAAMERRE
AMERRIRAMERRISSAGE
AMERRŐLAMERSFOORT
AMERSFOORT (NETHERLANDS)AMERTOY
AMERTUMEAMERY
AMÉRYAMERYK
AMERYKAAMERYKA ŁACIŃSKA
AMERYKA PÓŁNOCNAAMERYKA POŁUDNIOWA
AMERYKA ŚRODKOWAAMERYKANIN
AMERYKANISTAAMERYKANISTYKA
AMERYKANIZACJAAMERYKANIZM
AMERYKANIZOWAĆAMERYKANIZOWAĆ SIĘ
AMERYKANIZOWANYAMERYKANKA
AMERYKAŃSKIAMERYKAŃSKO
AMESAMES DAMNEES
ÂMES DAMNÉESAMES RESEARCH CENTER
AMES TESTAMES, ROBERT
AMES, WINTHROPAMES'SCHER RAUM
AMESCHA SPENTASAMESENDARSE
AMESITAMESITE
AMESQUINHADOAMESQUINHAR
AMESQUINHARSEAMESQUITE
AMESTECAMESTECA
AMESTECAREAMESTECAT
AMESTECĂTORAMESTECĂTURĂ
AMESTESTAMESTIZADO
AMESTIZARSEAMESTRADO
AMESTRADORAMESTRAMENTO
AMESTRARAMESTRARSE
AMESTRATUSAMESTRIVS
AMETAMETA
AMETABOLE INSEKTENAMETABOLIC
AMETABOLONAMETABOLOUS
AMETABOLOUS DEVELOPMENTAMETABOLOUS METAMORPHOSIS
AMETACHROMOPHILAMETAFIZYCZNIE
AMETAFIZYCZNYAMETAGESCHÄFT
AMETALADOAMETALAR
AMETALLOUSAMETAMORPHIC
AMETANEUTROPHILAMETASTEGIA CARPINI
AMETASTEGIA GLABRATAAMETASTEGIA PALLIPES
AMEŢEALĂAMETHOCAINE
AMETHODISCHAMETHODIST
AMETHOPTERINAMETHYST
AMETHYST HOTEL KHABAROVSK (KHABAROVSK)AMETHYST LODGE JASPER (JASPER)
AMETHYST POINTAMETHYST STARLING
AMETHYST WOODSTARAMÉTHYSTE
AMETHYSTENAMETHYSTFARBEN
AMETHYSTINAAMETHYSTINATUS
AMETHYSTINEAMETHYSTINE PYTHON
AMETHYSTINUSAMETHYSTMUTTER
AMETHYSTOSAMETHYSTS
AMETHYSTSAPHIRAMETHYSTUS
AMETIAMEŢI
AMETIAAMETIAEG
AMETIALANEAMETIASTE
AMETIKOHTAMETIKOHUST TÄITMA
AMETIKOHUSTUSTE TÄITMINEAMETIKÕRGENDUST ANDMA
AMETIKÕRGENDUST SAAMAAMETIMEES
AMETINIMETUSAMETIÕDE
AMETIÕPPIJAAMETIPOST
AMETIPRAKTIKAAMEŢIRE
AMETIREDELIL KERKIMAAMETIREDELIL TÕSTMA
AMETIREDELIL TÕUSMAAMETIRÜÜ
AMETIS OLEMAAMETIS PÜSIMA
AMETISSE ASTUMAAMETISSE PANEMA
AMETISTAMETIST LAHKUMINE
AMETISTAAMETISTA DEGLI URALI
AMETISTA ORIENTALEAMETISTO
AMETISZTAMEŢIT
AMETIT PIDAMAAMEŢITOR
AMETIÜHINGAMETIÜHINGU
AMETIÜHINGULINEAMETIVEND
AMETIVÕIMUDAMETKOND
AMETKONDADEVAHELINEAMETKONDLIK
AMETLIKAMETLIK DOKUMENT
AMETLIK TEADAANNEAMETLIKU KIRJAGA ÜMBRIK
AMETLIKULTAMETNIK
AMETNIKKONDAMETNIKU
AMETNIKUDAMETNIKUHING
AMETOECIOUSAMETRALLADOR
AMETRALLADORAAMETRALLAR
AMETRIAAMETRÍA
AMETRIC MANIFOLDAMETRIC PLANE
AMETRIEAMETRISCH
AMETROHEMIAAMETROMETER
AMETRONSPEEDMETERAMÉTROPE
AMETROPIAAMETROPIA ASSIALE
AMETROPIA DA RIFRAZIONEAMETROPIC
AMETROPIEAMÉTROPIE
AMÉTROPIE SPHÉRIQUEAMETROPY
AMETROUSAMETRYNE
AMÉTRYNEAMETS
AMETSUCHIAMETÜST
AMETYSTAMETYST HOTEL PRAGUE (PRAGUE)
AMETYSTOWOAMETYSTOWY
AMEUBLEMENTAMEUBLIR
AMEUBLISSEMENTAMEUBLISSEMENT DU FILTRE PAR L'EAU
AMEUTEMENTAMEUTER
AMEUTER LE QUARTIERAMEX
AMEX AMERICAN STOCK EXCHANGEAMEX AMERICAN EXPRESS
AMEX CARDAMEX COMMODITIES CORPORATION
AMEX COMPOSITE INDEXAMEX MAJOR MARKET INDEX
AMEX MARKET VALUE INDEXAMEX MMI
AMEX OPTIONS SWITCHING SYSTEMAMEX, AMERICAN STOCK EXCHANGE
AMEXCOAMEYA
AMEYALAMEZINHADOR
AMEZINHARAMEZQUINDARSE
AMEZYTAMF
AMFENACAMFETAMIN
AMFETAMINAAMFETAMINE
AMFETAMINKAAMFETAMINOWO
AMFETAMINOWYAMFI
AMFIASTRAMFIBI
AMFIBIAAMFIBIE
AMFIBIETANKAMFIBIJNIE
AMFIBIJNYAMFIBISCH
AMFIBISKAMFIBIU
AMFIBIUMAMFIBOL
AMFIBOLITAMFIBOLIZACE
AMFIBOLOGIAAMFIBOLOGIE
AMFIBOLOVÁ BŘIDLICEAMFIBOLOVEC
AMFIBOLOVÝ AZBESTAMFIBRACH
AMFIBRACHICZNYAMFIBRACHIKUS
AMFIBRACHISZAMFIBRACHYS
AMFIBRAHAMFIBROCHYS
AMFIDIPLOIDIEAMFIGAMIE
AMFIGASTRIUMAMFIGENEZE
AMFIIBAMFIIBSÕIDUK
AMFIKARPIEAMFILADA
AMFILADOWOAMFILADOWY
AMFIŁOCHIJEWICZAMFIŁOCHIJEWNA
AMFIŁOCHJEWICZAMFIŁOCHJEWNA
AMFIMIXIEAMFIOKSUS
AMFIONAMFIÓN
AMFIPROSTYLOSAMFIS
AMFISTOMÓZAAMFITEATER
AMFITEATER -N -RARAMFITEATR
AMFITEÁTRAMFITEATRÁLNÍ
AMFITEATRALNIEAMFITEATRALNY
AMFITEATRALSKAMFITEATRU
AMFITEÁTRUMAMFITEÁTRUMSZERŰ
AMFITEATTERIAMFITHEATER
AMFITRICHAAMFITRION
AMFITRYTAAMFM STEREO
AMFOFILNIEAMFOFILNY
AMFOLITAMFOLYT
AMFONELICAMFOR
AMFORAAMFORĂ
AMFORTASAMFORYCZNIE
AMFORYCZNYAMFOTERNÍ
AMFOTERNÍ ELEKTROLYTAMFOTERNÍ ION
AMFOTERNÍ KYSLIČNÍKAMFOTERNÍ OXID
AMFOTERNOSTAMFOTERYCZNIE
AMFOTERYCZNYAMFR
AMGAMGA
AMGLEICHRICHTERAMGLEICHRICHTUNG
AMGSAMGUEDDFA
AMGUEDDFEYDDAMGYLCH
AMHACHAMHÀIN
ÀMHAINNAMHAIRC
AMHARAAMHARC
AMHARCLANNAMHARIA
AMHARICAMHARIQUE
AMHARISCHAMHEIDA
AMHERSTAMHERST COLLEGE
AMHERST, FRANCIS KERRIL, D.D.AMHERSTIT
AMHERSTITEAMHEUS
AMHLAOIBHAMHOSIB(L)
AMHSAMI
AMI AU PRÊTER ENNEMI AU RENDREAMI AU PRÊTER, ENNEMI AU RENDRE.
AMI CODEAMI DE COUR
AMI DE LA DERNIÈRE HEUREAMI DE LA MAISON
AMI DE LA PREMIÈRE HEUREAMI DE PLATON MAIS PLUS ENCORE DE LA VÉRITÉ
AMI DE POUCHKINE, UN; UN AMI DE POUCHKINE [ИСТОЧНИК: НЕТ У МАСАНОВА]AMI DE TABLE EST BIEN VARIABLE
AMI DE TOUT LE MONDEAMI DE TOUTES LES HEURES
AMI DES MAUVAIS JOURSAMI JUSQU'À L'ÉCHAFAUD
AMI JUSQU'À LA BOURSEAMI JUSQU'À LA MORT
AMI PROAMI VIOLATION
AMIAAMIABIL
AMIABILITIESAMIABILITY
AMIABLEAMIABLE COMPOSITEUR
AMIABLE COMPOSITIONAMIABLE RELATIONSHIP
AMIABLENESSAMIABLY
AMIACASAMIAE
AMIĂNGAMIANT
AMIANT(H)USAMIANTA
AMIANTĂAMIANTE
AMIANTE À ARMATURE D'ACIERAMIANTE BÉTON
AMIANTE BROYÉAMIANTE CHRYSOTILE
AMIANTE CIMENTAMIANTE COURTE SOIE
AMIANTE EN BOURREAMIANTE EN FIBRE
AMIANTE PALLADIÉAMIANTE PLATINÉ
AMIANTE TISSABLEAMIANTECIMENT
AMIANTHAMIANTHOID
AMIANTHOSISAMIANTHUS
AMIANTIFÈREAMIANTIN
AMIANTINEAMIANTKUPFER
AMIANTOAMIANTO AL PALADIO
AMIANTO AL PALLADIOAMIANTO ANFIBOLO
AMIANTO AZZURROAMIANTO BLU
AMIANTO CRISOTILICOAMIANTO CRISOTILO
AMIANTO CRUDOAMIANTO DI ACTINOLITE
AMIANTO DI CRISOTILOAMIANTO DI SERPENTINO
AMIANTO DI TREMOLITEAMIANTO FIBROSO
AMIANTO IN FOGLIAMIANTO IN ROTOLI
AMIANTO PLATINADOAMIANTO PLATINATO
AMIANTO POLVERIZZATOAMIANTO VINILICO
AMIANTO VULCANIZZATOAMIANTOPAL
AMIANTOSAMIANTOWY
AMIANTSCHIEFERAMIANTUS
AMIASAMIAS, VEN. JOHN
AMIATINUS, CODEXAMIATIT
AMIATTAMIAZ
AMIAZĂAMIAZĂZI
AMIAZIAMIBA
AMIBĂAMIBE
AMIBE DU CÔLONAMIBE DYSENTÉRIQUE
AMIBE HÉMATOPHAGEAMIBE PROTÉE
AMIBENAMIBÈNE
AMIBIARSONAMIBIASE
AMIBIASE COLIQUEAMIBIASE INTESTINALE
AMIBIÁSICOAMIBIEN
AMIBIENNEAMIBIFORME
AMIBOAMIBOÏDE
AMIBOIDEOAMIBŐL
AMICAMICA
AMICA LUTO SUS.AMICAAL
AMICABILISAMICABILITIES
AMICABILITYAMICABLE
AMICABLE ACTIONAMICABLE ADJUSTMENT
AMICABLE AGREEMENTAMICABLE ARRANGEMENT
AMICABLE ASSURANCE SOCIETYAMICABLE COMPOUNDER
AMICABLE EXCHANGE OF VIEWSAMICABLE INTEGERS
AMICABLE MEANSAMICABLE NUMBERS
AMICABLE PAIRAMICABLE RELATIONS
AMICABLE SETTLEMENTAMICABLE SETTLEMENT OF DIFFERENCES BETWEEN STATES
AMICABLE SUITAMICABLENESS
AMICABLYAMICABLY SETTLE A DISPUTE
AMICACINUMAMICAL
AMICALEAMICALEMENT
AMICALISAMICALITEIT
AMICARAMICARE
AMICARSIAMICE
AMICÉTINEAMICHAI
AMICHAI, YEHUDAAMICHAR
AMICHETTAAMICHETTO
AMICHEVOLEAMICHEVOLEZZA
AMICHLORALAMICHO
AMICHUAMICI
AMICI DIVITUM PALEAE SUNT CIRCA GRANUM.AMICI PRINCIPIS
AMICI PRISMAMĪCI, DIEM PERDIDI
AMICIA, S.AMICIBERTRANDLINSE
AMICIBORAMICIDE
AMICIEAMICIMEN
AMICINUSAMICIO
AMICIPRISMAAMICIRE
AMICISAMICITER
AMICITIAAMICITIA INTER POCULA CONTRACTA PLERUMQUE VITREA EST
AMICITIA NISI INTER BONOS ESSE NON POTESTAMICITIA PARES AUT ACCIPIT, AUT FACIT.
AMICITIAE SUNT DISSENTENDAE MAGIS QUAM DISCINDENDAE.AMICITIAS IMMORTALES ESSE DEBERE.
AMICITIAS TIBI JUNGE PARES.AMICIŢIE
AMICITIESAMICIZIA
AMICIZIA RICONCILIATA È COME PIAGA MAL SALDATA.AMICO
AMICO, ANTONIOAMICO, FRANCESCO
AMICONEAMICROBIC
AMICRONAMICRONUCLEATE
AMICROSCOPICAMICT
AMICTICAMICTIC EGG
AMICTIC LAKEAMICTORIUM
AMICTUSAMICULA
AMICULUMAMICULUM OF OLIVE
AMICULUSAMICUM ESSE UNUM ANIMUM IN DUOBUS CORPORIBUS.
AMICUSAMICUS (4)
AMICUS CERTUSAMÍCUS CERTUS ÍN R(E) INCERTA CÉRNITUR
AMICUS CERTUS IN RE INCERTA CERMITURAMICUS CERTUS IN RE INCERTA CERNITUR
AMICUS CERTUS IN RE INCERTA CERNITUR.AMĪCUS COGNOSCITUR AMŌRE, MORE, ORE, RE
AMICUS CURIAEAMICUS CURIAE BRIEF
AMICUS DIU QUAERITUR, VIX INVENITUR, DIFFICILE SERVATUR.AMICUS HUMANI GENERIS
AMĪCUS HUMĀNI GENERISAMĪCUS INCOMMODUS AB INIMĪCO NON DIFFERT
AMICUS OLLARIS.AMICUS PLATO
AMICUS PLATO SED MAGIS AMICA EST VERITASAMICUS PLATO, AMICUS SOCRATES, SED PRAEHONORANDA VERITAS.
AMICUS PLATO, SED MAGIS AMICA (EST) VERITASAMICUS PLATO, SED MAGIS AMICA EST VERITAS
AMICUS PLATO, SED MAGIS AMICA VERITASAMĪCUS PLATO, SED MAGIS AMĪCA VERITAS
AMICUS PLATO, SED MAGIS AMICA VERITAS.AMICUS PLATO, SED MAGIS ARNICA VERITAS
AMĪCUS SOCRATES, SED MAGIS AMĪCA VERITASAMICUS UND AMELIUS
AMICUS, S. (1)AMICUS, S. (2)
AMICUS, SS. (3)AMÍCVS
AMICYANINAMID
AMID CLAIMS OF ATROCITIESAMID CONTINUING PROTESTS
AMID CRIES OF WELCOMEAMID KYSELINY
AMID KYSELINY MRAVENČÍAMID KYSELINY OCTOVÉ
AMID KYSELINY SEBAKOVÉAMID LOUD APPLAUSE
AMID SODNÝAMID TIGHT SECURITY
AMIDAAMIDĂ
AMIDA, S.AMIDABLE
AMIDACEOAMIDACETAL
AMIDAEUS, B.AMIDAMINAL
AMIĐANAMIDAPSONE
AMIDAREAMIDASE
AMIDASESAMIDASI
AMIDATEAMIDATING
AMIDATING AGENTAMIDATION
AMIDATION SITEAMIDATURA
AMIDÁZAAMIDAZIONE
AMIDBINDUNGAMIDE
AMIDE ACÉTIQUEAMIDE ACID
AMIDE ACRYLIQUEAMIDE BOND
AMIDE CHLORIDEAMIDE DE PURPURINE
AMIDE FAST ORANGEAMIDE NITROGEN
AMIDE TAUTOMERISMAMIDEI, SERGIO
AMIDENEAMIDES
AMIDES HYDRAZINIQUESAMIDES PRIMAIRES
AMIDES SECONDAIRESAMIDES TERTIAIRES
AMIDESSYNTHÉTASESAMIDHARZ
AMIDHYDRAZONAMIDHYDROLASE
AMIDIAMIDICKÁ SKUPINA
AMIDICKÁ VAZBAAMIDICKÝ
AMIDIERENAMIDIERUNG
AMIDIFICATIONAMIDIN
AMIDINASEAMIDINÁZA
AMIDINBINDUNGAMIDINE
AMIDINESAMIDINO
AMIDINOGRUPPEAMIDINOGUANIDIN
AMIDINOTRANSFERASEAMIDIQUE
AMIDITHIONAMIDLIGAND
AMIDMISCHFUTTERAMIDMOST
AMIDOAMIDO ANIMALE
AMIDO BLACKAMIDO DI MAIS
AMIDO DI MARANTAAMIDO DI PATATE
AMIDO GROUPAMIDO MODIFICATO
AMIDO...AMIDOADO
AMIDOALKYLATIONAMIDOALKYLIERUNG
AMIDOAZOBENZÈNEAMIDOAZOBENZOL
AMIDOAZOTOLUENEAMIDOBENZENE
AMIDOBENZOLAMIDOCARBOXYLÉ
AMIDOCHLORIDEAMIDOCYANOGÈNE
AMIDOGENAMIDOGRUPPE
AMIDOHEXOSEAMIDOHYDROLASE
AMIDOKOHLENSÄUREAMIDOL
AMIDOLENTWICKLERAMIDOLO
AMIDOLYSEAMIDOLYSIS
AMIDOMETHYLATIONAMIDOMETHYLIERUNG
AMIDOMYCINEAMIDON
AMIDŐNAMIDON ANIMAL
AMIDON DE LICHENAMIDON DE MOUSSE
AMIDON LÉVOGYREAMIDON SOLUBLE
AMIDONNAGEAMIDONNÉ
AMIDONNERAMIDONNERIE
AMIDONNIERAMIDONNIÈRE
AMIDOPHENOLAMIDOPHÉNOL
AMIDOPHOSPHATEAMIDOPIRINA
AMIDOPÜRIINAMIDOPYRAZOLINE
AMIDOPYRINAMIDOPYRINE
AMIDOPYRINUMAMIDOSÄUREN
AMIDOSCHWEFELSÄUREAMIDOSKUPINA
AMIDOSLOUČENINAAMIDOSSIME
AMIDOSTOMATÓZAAMIDOSTOMUM
AMIDOSULFATAMIDOSULFATE
AMIDOSULFONSÄUREAMIDOTHION
AMIDOVÁ SKUPINAAMIDOVÁNÍ
AMIDOVERBINDUNGAMIDOVÝ
AMIDOVÝ DUSÍKAMIDOWANIE
AMIDOWOAMIDOWY
AMIDOXALYLAMIDOXALYLE
AMIDOXIMAMIDOXIME
AMIDOXIMESAMIDRAZON
AMIDRAZONESAMIDS
AMIDSÄUREAMIDSHIP
AMIDSHIP HELIPORTAMIDSHIPS
AMIDSHIPS AREA RATIOAMIDSHIPS BEAM RATIO
AMIDSHIPS COMPENSATORAMIDSHIPS DEPTH
AMIDSHIPS DRAFT RATIOAMIDSHIPS LAUNCHER
AMIDSHIPS STRUCTUREAMIDSHIPS SUPERSTRUCTURE
AMIDSHIPSENGINEDAMIDST
AMIDST THE WORST CRISISAMIDTROCKENSCHNITZEL
AMIDULINAMIDULINE
AMIDZUCKERSCHNITZELAMIE
ÄMIEAMIEIRA
AMIEIROAMIEL
AMIEL WEEKS WHIPPLEAMIEL, MOSES AVIGDOR
AMIELIAAMIÉNOIS
AMIÉNOISEAMIENS
AMIENS (FRANCE)AMIENS, DIOCESE OF
AMIENS, MISE DEAMIÉRT
AMIES, SIR HARDYAMIÉSGADO
AMIETAMIEZ
AMÍGAMIGA
AMIGABILIDADAMIGABLE
AMIGABLE COMPONEDORAMIGABLE COMPOSICIÓN
AMIGACHOAMIGALHAÇO
AMIGALHOTEAMIGAR
AMIGARSEAMIGÁVEL
AMIGAZOAMIGDALA
AMIGDALĂAMÍGDALA
AMIGDALA DI GERLACHAMIGDALA PALATINA
AMIGDALÁCEOAMIGDALECTOMIA
AMIGDALICOAMIGDALIN
AMIGDALINAAMIGDALITĂ
AMIGDALITEAMIGDALITE ACUTA
AMIGDALITISAMIGDALOID
AMIGEAMIGEN
AMIGOAMIGO DA ONÇA
AMIGO DE COPOAMIGO DE PENICHE
AMIGO DE TAÇAAMIGO DO ALHEIO
AMIGO HOTEL BRUSSELS (BRUSSELS)AMIGO URSO
AMIGONIAMIGOS
AMIGOSATAMIGOTE
AMIGRADINUS, S.AMIGRO
AMIGUEIROAMIGUERO
AMIGUISMOAMÎINA
AMIKAMIKAAL
AMIKACINAMIKACINI SULFAS
AMIKALAMIKAZOL
AMIKEBENEAMIKIN
AMIKINUMAMIKOR
AMIKOSZONERIAAMIKROBIOSE
AMIKRONAMIKROSKOPISCH
AMIKROSKOPISCHER BAUFEHLERAMIKT
AMIKTISCHAMIL
AMILACEOAMILÁCEO
AMILACETATOAMILACEU
AMILALKOHOLAMILAMINA
AMILANADOAMILANAR
AMILANARSEAMILAND
AMILASIAMILÁZ
AMILAZĂAMILBENZOLO
AMILCARAMILCARE
AMILDARAMILE
AMILE BENZOATOAMILE BUTIRRATO
AMILE CARBAMMATOAMILE NITRITO
AMILEMERCAPTANOAMILENE
AMILESIAMILFENOLO
AMILIAMILICO
AMÍLICOAMILIFU
ÄMILISCHE STRAßEÄMILIUS
AMILLARARÁMILLI
AMILLONADOAMILLONAR
AMILODESTRINAAMILOID
AMILOIDEAMILOIDISMO
AMILOIDOSIAMILOIDOSI EPATICA
AMILOIDOSI NODULAREAMILOIDOSI PRIMITIVA
AMILOIDOSI RENALEAMILOIDOSI SECONDARIA
AMILOIDOSISAMILOLISI
AMILOPECTINAAMILOPLASTI
AMILOPSINAAMILORIDE
AMILORIDUMAMILOSIO
AMILPASAMILY
AMILYENAMIM
AMIMALHARAMIMAR
AMIMIAAMIMIC
AMIMIEAMIMIE MOTRICE
AMIMIE RÉCEPTIVEAMIMIQUE
AMINÂMIN
AMIN DADAAMIN, NAWSHIRWAN MUSTFAFA
AMIN(A)AMINA
AMINĂAMINACE
AMINACRINEAMINADAB
AMINAEAAMINAEUS
AMINALAMINALESTER
AMINALGÉSINEAMINALONE
AMINALONUMAMÎNAR
AMÎNAREAMINARSONE
AMINASEAMINASECAFRAME
AMÎNATAMINATE
AMINATING AGENTAMINATION
AMINATION OXYDANTEAMINATION OXYDATIVE
AMINAZINEAMINAZINUM
AMINCAMINCHE
AMINCIAMINCIR
AMINCISSANTAMINCISSANTE
AMINCISSEMENTAMINCISSEMENT DE LA RACINE DE DENT
AMINCISSEMENT DE LA SECTIONAMINCISSEMENT DU CRISTAL
AMINCISSEMENT DU RÉSEAUAMINDIYL
AMÎNDOIAMINE
AMINÉAMINE ANTIOXIDANT
AMINE CAKE FILTER PACKAGEAMINE CHARCOAL FILTER
AMINE COMPOUNDAMINE CURING AGENT
AMINE FILTRATIONAMINE FLASH DRUM
AMINE FUELAMINE HEAT EXCHANGE
AMINE MAKEUPAMINE NITROGEN
AMINE OXIDASEAMINE REBOILER
AMINE REFLUX SEPARATORAMINE REFLUX SYSTEM
AMINE REGENERATIONAMINE REGENERATOR
AMINE REGENERATOR PUMPAROUND COOLING SYSTEMAMINE REGENERATOR REBOILER
AMINE RINGAMINE SIMPATICOMIMETICHE
AMINE STRIPPERAMINE SUMP
AMINE SUMP TANKAMINE SURGE TANK
AMINE TREATINGAMINE TREATING UNIT
AMINE UNITAMINE WASHING
AMINEALKYLPHOSPHONOUSAMINEBORANE
AMINÉEAMINES
AMINES ACÉTYLÉNIQUESAMINES ALIPHATIQUES
AMINES AROMATIQUESAMINES BIOGÉNIQUES
AMINES CUREDAMINES CYCLIQUES
AMINES ÉPIMÉRIQUESAMINES GRASSES
AMINES HÉTÉROCYCLIQUESAMINES INSATURÉES
AMINES MIXTESAMINES NITROSÉES
AMINES PRIMAIRESAMINES QUATERNAIRES
AMINES SECONDAIRESAMINES TERTIAIRES
AMINESCUREDAMINETYPE ANTIOXIDANT
AMINEUM VINUMAMING
AMINHARZAMINI
AMINIASAMINICKÁ PRYSKYŘICE
AMINICOTINEAMINIEREN
AMINIERUNGAMINIERUNGSKATALYSATOR
AMINIFUAMINIKA
AMINIPLASTICSAMINISHA
AMINITROZOLEAMINIUM
AMINIWAAMINIZATION
AMINKARMÍNAMINKOLPITIS
ÁMINNAAMINNELS
ÁMINNINGÅMINNING
AMINOAMINŐ
AMINO ACIDAMINO ACID ACTIVATION
AMINO ACID ANALYZERAMINO ACID ATTACHMENT SITE
AMINO ACID COMPOSITIONAMINO ACID COPOLYMER
AMINO ACID DEFICIENT DIETAMINO ACID DERANGEMENT
AMINO ACID PERMEASEAMINO ACID POOL
AMINO ACID PROFILEAMINO ACID RECEPTORS
AMINO ACID SEQUENCEAMINO ACID SEQUENCING
AMINO ACID TRANSMITTERSAMINO ACIDS
AMINO ACYL ADENILATEAMINO ALCOHOL
AMINO ALCOHOLSAMINO BENZENE ARSONIC ACID
AMINO CAPROIC ACIDAMINO CAPRONIC ACID
AMINO CARBAMIC ACIDAMINO COMPOUND
AMINO GROUPAMINO OXIDASES
AMINO PLASTICAMINO PLASTICS
AMINO RESINAMINO SUGAR
AMINO SUGARSAMINO TERMINAL END
AMINO TERMINUSAMINO...
AMINO(ALKYLIDENAMINO)CARBENKOMPLEXAMINO4ANTIPYRINE
AMINO4PURINEAMINOACÉTAL
AMINOACÉTAMIDEAMINOACETATE
AMINOACETICAMINOACETIC ACID
AMINOACÉTONEAMINOACÉTONITRILE
AMINOACETYLAMINOACID
AMINOACID ANALYZERAMINOACID REPLACEMENT
AMINOACID RESIDUALAMINOACID RESIDUE
AMINOACIDEAMINOACIDEDÉCARBOXYLASE
AMINOACIDEDÉSHYDROGÉNASEAMINOACIDEMIA
AMINOACIDEOXYDASEAMINOACIDERACÉMASE
AMINOACIDESAMINOACIDES CÉTOGÈNES
AMINOACIDES ESSENTIELSAMINOACIDES LIBRES
AMINOACIDIAMINOACIDO
AMINOÁCIDOAMINOACIDO ALIFATICO
AMINOACIDOPATHYAMINOACIDURIA
AMINOACRICHINUMAMINOACRIDINE
AMINOACYLAMINOACYL RIBOSOME SITE
AMINOACYL SITEAMINOACYL TRNA
AMINOACYL TRNA SYNTHETASESAMINOACYLADENYLATE
AMINOACYLASEAMINOACYLATED TRANSFER RNA
AMINOACYLATIONAMINOACYLTRANSFERASE
AMINOACYLTRNAAMINOACYLTRNA BINDING SITE
AMINOACYLTRNA SYNTHETASEAMINOACYLTRNA SYNTHETASES
AMINOACYLTRNABINDING SITEAMINOACYLTRNASYNTHETASE
AMINOADIPIC ACIDAMINOALCOOLS
AMINOALDEHYDEAMINOALDEHYDHARZE
AMINOALKOHOLAMINOALKOHOLE
AMINOALKYLIERUNGAMINOAMEISENSÄURE
AMINOANTHRACÈNEAMINOANTHRACHINON
AMINOANTHRAQUINONEAMINOÄTHAN
AMINOÄTHANSÄUREAMINOÄTHER
AMINOÄTHYLBENZOLAMINOAZETAL
AMINOAZETANILIDAMINOAZIDURIE
AMINOAZOBARVIVOAMINOAZOBENZEN
AMINOAZOBENZÈNEAMINOAZOBENZOLSULFONSÄURE
AMINOAZOFARBSTOFFAMINOAZOSLOUČENINA
AMINOAZOTOLUENEAMINOAZOVERBINDUNG
AMINOBASEAMINOBENSEEN
AMINOBENZALDÉHYDEAMINOBENZAMIDE
AMINOBENZENAMINOBENZENE
AMINOBENZÈNEAMINOBENZÍN
AMINOBENZOATEAMINOBENZOESÄURE
AMINOBENZOESÄUREÄTHYLESTERAMINOBENZOESÄUREBUTYLESTER
AMINOBENZOESÄURENAMINOBENZOIC
AMINOBENZOIC ACIDAMINOBENZOL
AMINOBENZOLSULFONAMIDAMINOBENZOLSULFONSÄURE
AMINOBENZONITRILEAMINOBENZOYL
AMINOBENZOYLISÄUREAMINOBENZOYLJSÄURE
AMINOBENZYLAMINEAMINOBERNSTEINSÄURE
AMINOBUTTERSÄUREAMINOBUTYRATE
AMINOBUTYRICAMINOBUTYRIC ACID
AMINOCAÏNEAMINOCAPROIC
AMINOCAPROIC ACIDAMINOCAPROLACTAME
AMINOCAPRONIC ACIDAMINOCARB
AMINOCARB(E)AMINOCARBONSÄURE
AMINOCARBONSÄURENAMINOCARBONYL
AMINOCARBOXYBENZÈNEAMINOCHINOLIN
AMINOCHINOLUMAMINOCHRYSÈNE
AMINOCOLLEAMINOCOMPOUND
AMINOCOUMARINAMINOCROVINUM
AMINOCUKRAMINOCYCLOPROPANCARBONSÄURE
AMINOCYCLOPROPANE CARBOXYLIC ACIDAMINOCYCLOPROPANE CARBOXYLIC ACID SYNTHASE
AMINODÉRIVÉAMINODIKARBONSÄURE
AMINODIMETHYLBENZOLAMINODINITROPHENOL
AMINODUSÍKAMINOESSIGSÄURE
AMINOESTERAMINOETHAN
AMINOETHANEAMINOETHANOL
AMINOÉTHANOLAMINOETHANSULFONSÄURE
AMINOETHANTHIOLAMINOETHYL
AMINOETHYL CELLULOSEAMINOETHYLATION
AMINOÉTHYLPHÉNOLAMINOETYLALKOHOL
AMINOFENOLAMINOFERÁZE
AMINOFFITAMINOFLUORANTHÈNE
AMINOFLUOREKAMINOFLUORÈNE
AMINOFORMAMINOFORMALDEHYDHARZ
AMINOFORMIATAMINOFORMIC
AMINOFORMYLBENZÈNEAMINOGÈNE
AMINOGENESISAMINOGLUTARIC
AMINOGLUTARIC ACIDAMINOGLUTETHIMIDE
AMINOGLYCOSIDEAMINOGLYCOSIDE ANTIBIOTIC
AMINOGLYCOSIDE ANTIBIOTICSAMINOGLYCOSIDES
AMINOGLYKOSIDAMINOGLYKOSIDANTIBIOTIKA
AMINOGRAMAMINOGRUPPE
AMINOGRUPPENHERAUSNAHMEAMINOGRUPPENUMSTELLUNG
AMINOGSALZAMINOGSÄURE
AMINOGUANIDINAMINOGUANIDINE
AMINOHETEROCYCLICAMINOHEXANSÄURELACTAM
AMINOHIPPURATEAMINOHIPPURIC
AMINOHYDROLASEAMINOHYDROXYBENZOIC
AMINOHYDROXYBUTYRIC ACIDAMINOHYDROXYLATION
AMINOIMIDAZOLASEAMINOIMIDAZOLE CARBOXYLIC ACID
AMINOIMINOMETHYLAMINOINDÈNE
AMINOISOBUTYRICAMINOISOBUTYRIC ACID
AMINOISOVALERIANSÄUREAMINOKAPRONOWY
AMINOKARBONSÄUREAMINOKETON
AMINOKETONEAMINOKOMPONENTE
AMINOKREBSAMINOKROVIN
AMINOKWASAMINOKWASOWO
AMINOKWASOWYAMINOKWASY
AMINOKYSELINAAMINOKYSELINOVÝ
AMINOLÄVULINSÄUREAMINOLEVULINATE
AMINOLEVULINATE SYNTHASEAMINOLEVULINIC
AMINOLEVULINIC ACIDAMINOLIPID
AMINOLIPIDSAMINOLIPIN
AMINOLYSEAMINOLYSIS
AMINOMALEICAMINOMETHAN
AMINOMETHANEAMINOMETHYLIEREN
AMINOMETHYLIERUNGAMINOMETRADINE
AMINOMETRAMIDEAMINOMÉTRIE
AMINONAFTOLAMINONAPHTALÈNE
AMINONAPHTHALINAMINONAPHTHALINDISULFONSÄURE
AMINONAPHTHALINSULFONSÄUREAMINONAPHTHOL
AMINONAPHTHOLDISULFONSÄUREAMINONAPHTHOLE
AMINONAPHTHOLSULFONSÄUREAMINONAPHTHOLSULFONSÄUREN
AMINONAPHTOLAMINONITROBENZOLE
AMINONITROGENAMINONITROTHIAZOLE
AMINOOCTOWOAMINOOCTOWY
AMINOOXIDÁZEAMINOOXY
AMINOOXYACETIC ACIDAMINOOXYDASE
AMINOOXYDASEHEMMERAMINOPARATHION
AMINOPENTAMIDEAMINOPEPTIDASE
AMINOPEPTIDASESAMINOPEPTIDÁZE
AMINOPHÉNANTRÈNEAMINOPHENAZON
AMINOPHENAZONEAMINOPHÈNE
AMINOPHENETOLAMINOPHENOL
AMINOPHÉNOLAMINOPHENOLÄTHYLÄTHER
AMINOPHENOLEAMINOPHENYL
AMINOPHENYLESSIGSÄUREAMINOPHERASE
AMINOPHOSPHINEAMINOPHYLLINE
AMINOPIMELIC ACIDAMINOPLASMAL LS
AMINOPLASTAMINOPLAST MOULDING COMPOSITION
AMINOPLAST MOULDING COMPOUNDAMINOPLAST(IC)
AMINOPLASTEAMINOPLASTES
AMINOPLASTICAMINOPLASTIC RESIN
AMINOPLÁSTICOSAMINOPLASTKONDENSAT
AMINOPOLYKARBONSÄUREAMINOPOLYPEPTIDASE
AMINOPROMASINEAMINOPROPANOL
AMINOPROPANSÄUREAMINOPROPIONIC
AMINOPROPIONSÄUREAMINOPROPRIONSÄURE
AMINOPTERINAMINOPTERINE
AMINOPTÉRINEAMINOPTEROYLGLUTAMIC
AMINOPURINAMINOPURINE
AMINOPYRÈNEAMINOPYRIDINE
AMINOPYRIDINESAMINOPYRIN
AMINOPYRINEAMINOQUINOL
AMINOQUINOLÉINEAMINOQUINONE
AMINORACIÓNAMINORAR
AMINOREXAMINORSALZ
AMINORSÄUREAMINOSACCHARIDE
AMINOSALICYLATEAMINOSALICYLIC
AMINOSALICYLIC ACIDAMINOSALICYLSÄURE
AMINOSALIZYLSÄUREAMINOSÄURE
AMINOSÄUREANIONAMINOSÄUREBESTAND
AMINOSÄURECHELATAMINOSÄUREDATIERUNG
AMINOSÄUREDIABETESAMINOSÄUREEINHEIT
AMINOSÄUREFOLGEAMINOSÄUREGEMISCH
AMINOSÄUREIMBALANCEAMINOSÄUREIMBILANZ
AMINOSÄURENAMINOSÄUREN: BAUSTEINE DES LEBENS
AMINOSÄURENZUSAMMENSETZUNGAMINOSÄUREOXYDASE
AMINOSÄUREPRÄPARATEAMINOSÄUREREIHENFOLGE
AMINOSÄURERESTAMINOSÄURESEQUENZ
AMINOSÄUREUHRAMINOSÄUREZUSAMMENSETZUNG
AMINOSAVAMINOSIDINE
AMINOSISAMINOSKUPINA
AMINOSLOUČENINAAMINOSOL
AMINOSSÄUREAMINOSTIBURIA
AMINOSTICKSTOFFAMINOSTIGMINUM
AMINOSUCCINAMICAMINOSUCCINAMIC ACID
AMINOSUCCINAMIDEAMINOSUCCINIC
AMINOSUGARAMINOSULFIDE
AMINOSULFONSÄUREAMINOSURIA
AMINOSYNAMINOSYRA
AMINOSYREAMINOSYRER
AMINOTEILAMINOTERMINAL
AMINOTERMINAL ANALYSISAMINOTERMINAL DOMAIN
AMINOTERMINAL SEQUENCEAMINOTHIAZOLE
AMINOTHIOHARNSTOFFAMINOTHIOL PREPARATION
AMINOTHIOPHÉNOLAMINOTOLUOL
AMINOTRANSFERASEAMINOTRANSFERASES
AMINOTRANSFERASIAMINOTRATE
AMINOTROPHUMAMINOVÁ PRYSKYŘICE
AMINOVÁ SKUPINAAMINOVÁNÍ
AMINOVATAMINOVERBINDUNG
AMINOVÝ DUSÍKAMINOWAĆ
AMINOWOAMINOWY
AMINOXIDAMINOXIDASE
AMINOXIDEAMINOXYDASE
AMINOXYLAMINOXYLOL
AMINOZUCKERAMINOΕSÄURE
AMINSÄUREAMINT
AMINTEAMINTERI
AMINTHOGYAMINTI
AMINTIREAMINTIT
AMINŮAMINURIA
AMINUSAMINY
AMINY (7.P.)AMINYL
AMINYLENAMINZAHL
T: 161