Страница 298


DECKENLATERNEDECKENLAUFKATZE
DECKENLEHREDECKENLEUCHTE
DECKENLICHTDECKENLÜFTER
DECKENLUFTHEIZUNGDECKENLUFTKÜHLER
DECKENLÜFTUNGDECKENMACHEN
DECKENMACHMASCHINEDECKENMÄCHTIGKEIT
DECKENMALEREIDECKENMALEREI.
DECKENMANIPULATORDECKENMIETE
DECKENMOORDECKENMULDE
DECKENNETZSPINNENDECKENOBERLICHT
DECKENPAKETDECKENPANEEL
DECKENPENDELDECKENPFLASTER
DECKENPLATTEDECKENPUTZ
DECKENQUERSCHNITTDECKENRASTER
DECKENREFLEXIONDECKENREST
DECKENRIßDECKENRÜCKEN
DECKENSATTELDECKENSCHALTER
DECKENSCHALUNGDECKENSCHALUNGSHALTER
DECKENSCHEIBENDECKENSCHEITEL
DECKENSCHICHTDECKENSCHIENE
DECKENSCHLACKENDECKENSCHOTTER
DECKENSOHLEDECKENSTÄRKE
DECKENSTATIVDECKENSTEIN
DECKENSTEINEDECKENSTIRN
DECKENSTOFFEDECKENSTRAHLER
DECKENSTRAHLUNGSHEIZUNGDECKENSTRAHLUNGSKÜHLSYSTEM
DECKENSTÜCKDECKENSTÜTZE
DECKENSYSTEMDECKENTAFEL
DECKENTÄFELUNGDECKENTHEORIE
DECKENTOLERANZDECKENTRÄGER
DECKENTRANSPORTDECKENÜHERSCHIEBUNG
DECKENUNTERZUGDECKENVENTILATOR
DECKENVERDAMPFERDECKENVERKLEIDUNG
DECKENVERSCHALUNGDECKENVORGELEGE
DECKENVULKANISMUSDECKENWASCHMASCHINE
DECKENWEBSTUHLDECKENWIRBELBRENNER
DECKENWULSTDECKENWURZEL
DECKERDECKER KARL
DECKER TYPE PRESSDECKER, HANS
DECKER, JACQUES DEDECKERECTION
DECKERINGDECKERINNERUNG
DECKERLAUBNISDECKERNAGEL
DECKERSDECKERT
DECKFADENDECKFADENFUTTER
DECKFÄHIGDECKFÄHIGKEIT
DECKFALTEDECKFALTENGEBIRGE
DECKFARBEDECKFARBEN
DECKFARBENMALEREIDECKFARBENZURICHTUNG
DECKFÄRBUNGDECKFEDER
DECKFEDERNDECKFENSTER
DECKFLÄCHEDECKFLÜGEL
DECKFLÜGLERDECKFLUGZEUG
DECKFOLIEDECKFORM
DECKFRACHTDECKFRUCHT
DECKFUGEDECKFURNIER
DECKGANGDECKGARN
DECKGEAR LOCKERDECKGEBIRGE
DECKGEBIRGEVERHÄLTNISDECKGEBIRGSKAMM
DECKGEBIRGSSTRUKTURDECKGEBIRGSTEKTONIK
DECKGESIMSDECKGEWEBE
DECKGLASDECKGLÄSCHEN
DECKGLASPRÄPARATDECKGRÜN
DECKGRUNDDECKGUMMI
DECKHAARDECKHÄLFTE
DECKHAMMERDECKHAND
DECKHAUSDECKHEAD
DECKHEAD BUILDINGDECKHENGST
DECKHOLZDECKHÖLZER
DECKHOUSEDECKHOUSE AIRPORT
DECKHOUSE DECKDECKHOUSE FORECASTLE
DECKHOUSE PLATINGDECKINFEKTIONEN
DECKINGDECKING CHAIN
DECKING GEARDECKING LEVEL
DECKKABINEDECKKAPPE
DECKKASTENDECKKETTE
DECKKLÄREDECKKLÄRSEL
DECKKNOCHENDECKKRAFT
DECKKRÄFTIGDECKKULTUR
DECKLACKDECKLACKIEREN
DECKLADUNGDECKLAGE
DECKLAGENSCHWEIßENDECKLAKEN
DECKLANDEFLUGZEUGDECKLANDUNG
DECKLASCHEDECKLAST
DECKLASTERDECKLAUGE
DECKLAUNCHED SHOTDECKLE
DECKLE EDGEDECKLE EDGED
DECKLE EDGED PAPERDECKLEEDGED
DECKLEHMDECKLEISTE
DECKLERDECKLICHT
DECKLIGHTDECKLINE
DECKLINE AT SIDEDECKLOAD
DECKLOADEDDECKLOS
DECKLUKEDECKMAN
DECKMANNDECKMANTEL
DECKMARKEDECKMASCHE
DECKMASCHINEDECKMASSE
DECKMATTEDECKMEMBRAN
DECKMITTELDECKMORÄNE
DECKMOUNTED LAUNCHERDECKMUSTER
DECKNADELDECKNAME
DECKNAMENLISTEDECKNAMENVERZEICHNIS
DECKNERDECKNETZ
DECKNUMMERDĚCKO
DECKOFFIZIERDECKOFFIZIERE
DECKOPERATIONDECKOPERATIONEN
DECKPANZERDECKPAPPE
DECKPASSAGEDECKPASSAGIER
DECKPASSENGERDECKPAUSE
DECKPEILUNGDECKPFLASTER
DECKPIERCINGDECKPIERCING SHELL
DECKPILLARDECKPLANE
DECKPLANKDECKPLANKE
DECKPLANKENDECKPLATINE
DECKPLÄTTCHENDECKPLATTE
DECKPLATTEN PORÖSEDECKPLATZ
DECKPOLIERENDECKPOLITUR
DECKRASENDECKREISIG
DECKROOFDECKROTWEINE
DECKRÜDEDECKS
DECKS FOR ACTIONDECKSABSTÜTZUNG
DECKSALZDECKSAMER
DECKSANDDECKSAUFBAU
DECKSAUFBAUTENDECKSBALKEN
DECKSBALKENSTÜTZEDECKSBALKENUNTERSCHLAG
DECKSBEPLANKUNGDECKSBUCHT
DECKSCHAUFELDECKSCHEIBE
DECKSCHEIBENDECKSCHEIN
DECKSCHICHTDECKSCHICHTBILDUNG
DECKSCHICHTENBILDNERDECKSCHICHTKAPAZITÄT
DECKSCHICHTSPÄNEDECKSCHICHTWASSER
DECKSCHIENEDECKSCHLEUDER
DECKSCHOLLEDECKSCHOLLENGEBIRGE
DECKSCHRAUBENDECKSCHUPPE
DECKSCHUPPENDECKSESSEL
DECKSEUCHEDECKSFENSTER
DECKSFRACHTDECKSGLAS
DECKSHAUSDECKSIEB
DECKSITZWAGENDECKSJUNGE
DECKSKLÜSEDECKSKONTAINER
DECKSKRANDECKSLACK
DECKSLADUNGDECKSLAST
DECKSLEUCHTEDECKSLINIE
DECKSLOGDECKSLUKE
DECKSMANNDECKSMASCHINEN
DECKSÖFFNUNGDECKSOHLE
DECKSOMEONE OR SOMETHING OUT (WITH SOMETHING)DECKSPELZE
DECKSPLANDECKSPLANKE
DECKSPLANKEN, PLATTENDECKSPOLLER
DECKSPRUNGDECKSRAUM
DECKSSCHIENEDECKSSCHIFF
DECKSSCHOREDECKSSPRUNG
DECKSSTÜTZEDECKSTATION
DECKSTEINDECKSTELLEN
DECKSTOFFDECKSTRÄUCHER
DECKSTREFFERDECKSTRICH
DECKSTRINGERDECKSTROH
DECKSTROMDECKSTUHL
DECKSTÜTZEDECKSTÜTZEN
DECKSUNTERZUGDECKSWAGEN
DECKSWORPDECKTENNIS
DECKTERRASSEDECKTON
DECKTOPDECKTOP MOUNTING
DECKTRANSFORMATIONDECKTRUSS
DECKTUCHDECKTYPE BRIDGE
DECKTYPE REACTORDĚCKU
DECKUNGDECKUNG DER ZÜGE
DECKUNGSAUFGABEDECKUNGSAUFLAGE
DECKUNGSBAHNDECKUNGSBEGINN
DECKUNGSBEITRAGDECKUNGSBEITRAGSRECHNUNG
DECKUNGSFÄHIGKEITDECKUNGSFEHLER
DECKUNGSFEUERDECKUNGSFLUGZEUG
DECKUNGSGESCHÄFTDECKUNGSGLEICH
DECKUNGSGLEICHHEITDECKUNGSGRABEN
DECKUNGSGRADDECKUNGSGRUNDSÄTZE
DECKUNGSKAPITALDECKUNGSKARTE
DECKUNGSKAUFDECKUNGSLOCH
DECKUNGSLOSDECKUNGSLÜCKE
DECKUNGSMITTELDECKUNGSPRINZIP
DECKUNGSRÜCKSTELLUNGDECKUNGSSCHEIBE
DECKUNGSSIGNALDECKUNGSSIGNALE
DECKUNGSSPIELERDECKUNGSSPIELERIN
DECKUNGSSTOCKDECKUNGSSTOCKFÄHIGKEIT
DECKUNGSSUMMEDECKUNGSTRUPPE
DECKUNGSTRUPPENDECKUNGSVERHÄLTNIS
DECKUNGSVERKAUFDECKUNGSWECHSEL
DECKUNGSZUSAGEDECKVERBAND
DECKVERMÖGENDECKVERSCHRAUBUNGEN
DECKWANDDECKWART
DECKWARTHDECKWASH HOSE
DECKWEINDECKWEIß
DECKWERKDECKWERKE
DECKWERTDECKWERTH
DECKWIRTHDECKWORT
DECKZAHLDECKZANGE
DECKZEITDECKZELLE
DECKZIEGELDECL
DÉCL.DECLAIM
DECLAIM AGAINSTDECLAIMED
DECLAIMERDECLAIMING
DECLAIMSDECLAMA
DECLAMAÇÃODECLAMACIÓN
DECLAMADORDECLAMANDO
DECLAMARDECLAMARE
DÉCLAMATEURDECLAMATIE
DECLAMAŢIEDECLAMATIO
DECLAMATIONDÉCLAMATION
DECLAMATIONSDECLAMATIUNCULA
DÉCLAMATOIREDECLAMATOR
DECLAMATOREDECLAMATORIE
DECLAMATORIODECLAMATÓRIO
DECLAMATORIUSDECLAMATORY
DECLAMAZIONEDÉCLAMER
DECLAMERENDECLAMITO
DECLAMODÉCLAMPAGE
DÉCLAMPERDECLAMPING
DECLAMPING PHENOMENONDECLAN
DECLANŞADECLANŞARE
DECLANŞATORDECLANŞOR
DECLANUS, S. (1)DECLANUS, S. (2)
DECLARADECLARABLE
DÉCLARABLEDECLARABLE EFFECT
DECLARAÇÃODECLARACIÓN
DECLARACIÓN A HACIENDADECLARACIÓN ADUANERA
DECLARACIÓN ADUANERA DE EXPORTACIÓNDECLARACIÓN AMERICANA DE LOS DERECHOS Y DEBERES DEL HOMBRE
DECLARACIÓN ARANCELARIADECLARACIÓN AUTOINCULPATORIA
DECLARACIÓN CIVILDECLARACIÓN CONDENATORIA
DECLARACIÓN CONFESORIADECLARACIÓN CONFESORIA CIVIL
DECLARACIÓN CONFESORIA PENALDECLARACIÓN CONJUNTA
DECLARACIÓN CONSTITUIDA LA ASAMBLEADECLARACIÓN DE ABANDONO
DECLARACIÓN DE ACUSACIÓNDECLARACIÓN DE ADUANA
DECLARACIÓN DE AUSENCIA LEGALDECLARACIÓN DE AVERÍA
DECLARACIÓN DE CARGADECLARACIÓN DE CONCURSO
DECLARACIÓN DE CONCURSO DE ACREEDOREESDECLARACIÓN DE CONTRIBUCIÓN SOBRE INGRESOS
DECLARACIÓN DE CULPABILIDADDECLARACIÓN DE DERECHOS
DECLARACIÓN DE DIVISASDECLARACIÓN DE ENTRADA
DECLARACIÓN DE EXPEDICIÓNDECLARACIÓN DE EXPORTACIÓN
DECLARACIÓN DE FALLECIMIENTODECLARACIÓN DE FE DEMOCRÁTICA
DECLARACIÓN DE FIDEICOMISODECLARACIÓN DE GUERRA
DECLARACIÓN DE HABER O NO LUGAR A INFORMACIÓN DE CAUSADECLARACIÓN DE HEREDEROS
DECLARACIÓN DE IMPORTACIONESDECLARACIÓN DE IMPUESTO
DECLARACIÓN DE IMPUESTO SOBRE SUCESIONESDECLARACIÓN DE INCAPACIDAD
DECLARACIÓN DE INOCENCIADECLARACIÓN DE INSOLVENCIA
DECLARACIÓN DE MERCANCÍASDECLARACIÓN DE MORATORIA
DECLARACIÓN DE NO HA LUGARDECLARACIÓN DE NULIDAD
DECLARACIÓN DE PROCEDENCIA DE MERCANCÍADECLARACIÓN DE QUEBRA
DECLARACIÓN DE QUIEBRADECLARACIÓN DE REBELDÍA
DECLARACIÓN DE RECHAZODECLARACIÓN DE RECONOCIMIENTO
DECLARACIÓN DE RENTADECLARACIÓN DE RENUNCIA
DECLARACIÓN DE TESTIGODECLARACIÓN DE VOLUNTAD
DECLARACIÓN DEL ACUSADODECLARACIÓN DEL CARGADOR
DECLARACIÓN DEL PROCESADODECLARACIÓN EN MATERIA PENAL
DECLARACIÓN ESCRITADECLARACIÓN EXTRAJUDICIAL
DECLARACIÓN F DE INVERSIONES INTERNACIONALES Y CORPORACIONES TRANSNACIONALESDECLARACIÓN FALSA
DECLARACIÓN FINALDECLARACIÓN FISCAL
DECLARACIÓN FUERA DE LA LEYDECLARACIÓN IMPLÍCITA
DECLARACIÓN INAUGURALDECLARACIÓN INCOMPLETA
DECLARACIÓN INCULPATORIADECLARACIÓN INDAGATORIA
DECLARACIÓN INDAGATORIA CON CARGOSDECLARACIÓN INDIVIDUAL
DECLARACIÓN INEXACTADECLARACIÓN INFORMATIVA
DECLARACIÓN INMEDIATADECLARACIÓN INSTRUCTIVA
DECLARACIÓN JUDICIALDECLARACIÓN JURADA
DECLARACIÓN JURADA PARA EL PAGO DEL IMPUESTO SUCESORIODECLARACIÓN JURADA POR ESCRITO
DECLARACIÓN MEDIATADECLARACIÓN NEGOCIADA
DECLARACIÓN OFICIALDECLARACIÓN ORAL
DECLARACIÓN PARA EL PAGO DEL IMPUESTO SUCESORIODECLARACIÓN PERSONAL
DECLARACIÓN PETITORIADECLARACIÓN PREPARATORIA
DECLARACIÓN REALDECLARACIÓN RECEPTIVA
DECLARACIÓN SIN LUGARDECLARACIÓN TÁCITA
DECLARACIÓN TESTIMONIALDECLARACIÓN UNILATERAL DE MORATORIA
DECLARACIÓN UNILATERAL DE MORATORIA DE PAGOSDECLARACIONES
DECLARACIONES DE LAS PARTESDECLARACIONES DE TESTIGOS
DECLARACIONES FALSASDECLARACIONES TESTIFICALES
DECLARACIONES VERDADERASDECLARADAMENTE
DECLARADODECLARADO DE MÁS
DECLARADO DE MENOSDECLARADO REO
DECLARADORDECLARANT
DÉCLARANTDECLARANT ALIEN
DÉCLARANT EN DOUANEDECLARANTE
DÉCLARANTEDECLARAR
DECLARAR BAJO JURAMENTODECLARAR CESANTE
DECLARAR CON LUGARDECLARAR CULPABLE
DECLARAR CULPABLE DE LOS CARGOSDECLARAR DESIERTO
DECLARAR EL CONCURSODECLARAR IMPROCEDENTE
DECLARAR INOCENTEDECLARAR LA HUELGA
DECLARAR LA INCAPACIDADDECLARAR LA VERDAD
DECLARAR NULODECLARAR POR OFICIO
DECLARAR REODECLARAR SIN LUGAR
DECLARAR UN DIVIDENDODECLARARE
DECLARARE.DECLARARSE
DECLARARSE CULPABLEDECLARARSE EN QUEBRA
DECLARARSE INOCENTEDECLARARSE INSOLVENTE
DECLARARSE UNO EN DERROTADECLARAT
DÉCLARATEURDÉCLARATEUR DE ZONE
DECLARATIEDECLARAŢIE
DECLARATIEKOSTENDÉCLARATIF
DECLARATIODECLARATIO FERDINANDEA
DECLARATIONDÉCLARATION
DÉCLARATION À L'IMPÔTDÉCLARATION À L'IMPÔT SUR REVENU
DÉCLARATION ADMISE POUR CONFORMEDECLARATION AGAINST INTEREST
DECLARATION AGAINST SMTHDÉCLARATION AVEC ACCUSÉ DE RÉCEPTION
DÉCLARATION BILATÉRALEDECLARATION BY AUTHORITY
DÉCLARATION COMMUNEDÉCLARATION COMPLÉMENTAIRE
DECLARATION CONDITIONDÉCLARATION CONJOINTE
DÉCLARATION D'ABSENCEDÉCLARATION D'ACCESSION
DÉCLARATION D'ACTIVITÉDÉCLARATION D'ADHÉSION
DÉCLARATION D'AGGRAVATION DES RISQUESDÉCLARATION D'ALIMENT
DÉCLARATION D'APPELDÉCLARATION D'APPUI
DÉCLARATION D'ARRIVÉEDÉCLARATION D'AUTEUR
DÉCLARATION D'EMBAUCHAGEDÉCLARATION D'EMPLOI PRÉALABLE
DÉCLARATION D'ENGAGEMENTDÉCLARATION D'EXISTENCE
DÉCLARATION D'EXPORTATIONDÉCLARATION D'INDÉPENDANCE
DÉCLARATION D'INTENTIONDÉCLARATION D'OBLIGATION
DÉCLARATION D'UNE CRÉANCEDÉCLARATION D'URGENCE
DÉCLARATION D'USAGEDÉCLARATION D'UTILITÉ PUBLIQUE
DECLARATION DATEDECLARATION DAY
DÉCLARATION DE BIENSDÉCLARATION DE BLOCUS
DÉCLARATION DE CANDIDATUREDÉCLARATION DE CARGAISON
DÉCLARATION DE CHANGEMENT DE DOMICILEDÉCLARATION DE CHARGEMENT
DÉCLARATION DE COMMANDDÉCLARATION DE CONFORMITÉ
DÉCLARATION DE CRÉANCESDÉCLARATION DE DÉPART
DÉCLARATION DE DEVISESDÉCLARATION DE DIVIDENDES
DÉCLARATION DE DOUANEDÉCLARATION DE FAILLITE
DÉCLARATION DE FORTUNEDÉCLARATION DE GROSSESSE
DÉCLARATION DE GUERREDÉCLARATION DE GUERRE CONDITIONNELLE
DÉCLARATION DE JUGEMENT COMMUNDÉCLARATION DE L'ACCIDENT DU TRAVAIL
DÉCLARATION DE LA NAISSANCE D'UN ENFANTDÉCLARATION DE MARCHANDISES
DÉCLARATION DE NAISSANCEDÉCLARATION DE NEUTRALITÉ
DÉCLARATION DE PERSONA NON GRATADÉCLARATION DE PERTE
DÉCLARATION DE PERTE TOTALEDÉCLARATION DE POURVOI
DÉCLARATION DE PRÉSOMPTION DE DÉCÈSDÉCLARATION DE PRINCIPES
DÉCLARATION DE PRIORITÉDÉCLARATION DE RECONNAISSANCE
DÉCLARATION DE RÉEXPORTATIONDÉCLARATION DE RÉIMPORTATION
DÉCLARATION DE RÉSOLUTIONDÉCLARATION DE REVENUS
DÉCLARATION DE SORTIEDÉCLARATION DE SUCCESSION
DÉCLARATION DE TABLEAUDÉCLARATION DE TRANSIT
DÉCLARATION DE VACANCE D'EMPLOIDÉCLARATION DE VALEUR
DÉCLARATION DE VOLONTÉDÉCLARATION DES BÉNÉFICES
DÉCLARATION DES BIENSDÉCLARATION DES CHANTIERS TEMPORAIRES
DÉCLARATION DES DEVISESDÉCLARATION DES DROITS DE L'HOMME ET DU CITOYEN
DÉCLARATION DES PROCÉDÉS DE TRAVAILDÉCLARATION DU BÉNÉFICE
DÉCLARATION DU CONTRIBUABLEDÉCLARATION DU DÉLAISSEMENT
DÉCLARATION DU GOUVERNEMENT {GOUVERNEMENTALE}DÉCLARATION DU SINISTRE
DÉCLARATION ÉCRITEDÉCLARATION EN DÉTAIL
DÉCLARATION EN DOUANEDÉCLARATION EN FORME
DÉCLARATION EN LESTDÉCLARATION FINALE
DÉCLARATION FISCALEDECLARATION FOR CUSTOMS TRANSIT
DECLARATION FOR SMTHDECLARATION FORM
DÉCLARATION FORMELLEDÉCLARATION FRAUDULEUSE
DECLARATION IN CHIEFDECLARATION IN LIEU OF AN OATH
DECLARATION IN SUPPORTDECLARATION INSURANCE
DECLARATION INWARDSDÉCLARATION JUDICIAIRE DE DÉCÈS
DECLARATION LETTERDÉCLARATION MENSONGÈRE
DÉCLARATION MODIFICATIVE D'EXISTENCEDÉCLARATION NOTARIÉE
DECLARATION OF A BLOCKADEDECLARATION OF ABANDONMENT
DECLARATION OF ABSENCEDECLARATION OF ACCESSION
DECLARATION OF ACTUAL USE OF A MARKDECLARATION OF ALIENAGE
DECLARATION OF AMNESTYDECLARATION OF ASSENT
DECLARATION OF ASSOCIATIONDECLARATION OF AUTONOMY
DECLARATION OF BANKRUPTCYDECLARATION OF BLOCKADE
DECLARATION OF CANCELLATIONDECLARATION OF CAPACITY
DECLARATION OF COMMERCIALITYDECLARATION OF COMPLIANCE
DECLARATION OF CONFORMITYDECLARATION OF CONTENTS
DECLARATION OF CURRENT ASSETS MOVEMENTDECLARATION OF DEATH
DECLARATION OF DEFAULTSDECLARATION OF DIVIDEND
DECLARATION OF DIVIDENDSDECLARATION OF DOMICILE
DECLARATION OF DUTIABLE GOODSDECLARATION OF ESTIMATED TAX
DECLARATION OF EXEMPTIONDECLARATION OF EXPERT WITNESS
DECLARATION OF FORFEITUREDECLARATION OF FUNDAMENTAL RIGHTS
DECLARATION OF GOODSDECLARATION OF GUIDING PRINCIPLES ON THE USE OF SATELLITE BROADCASTING FOR THE FREE FLOW OF INFORMATION, THE SPREAD OF EDUCATION AND GREATER CULTURAL EXCHANGE
DECLARATION OF INABILITY TO PAY DEBTSDECLARATION OF INCAPACITY
DECLARATION OF INCAPACITY TO MANAGE OWN AFFAIRSDECLARATION OF INCOME
DECLARATION OF INDEMNITYDECLARATION OF INDEPENDENCE
DECLARATION OF INDULGENCEDECLARATION OF INSOLVENCY
DECLARATION OF INTENSIONDECLARATION OF INTENT
DECLARATION OF INTENT TO USE A MARKDECLARATION OF INTENTION
DECLARATION OF INTEREST IN DELIVERYDECLARATION OF INTERFERENCE
DECLARATION OF INVALIDITYDECLARATION OF INVENTOR
DECLARATION OF INVENTORSHIPDECLARATION OF LEGAL PRINCIPLES GOVERNING THE ACTIVITIES OF STATES IN THE EXPLORATION AND USE OF OUTER SPACE
DECLARATION OF LEGITIMACYDECLARATION OF LIEN
DECLARATION OF LOSS OF INSURED PROPERTYDECLARATION OF MAJORITY
DECLARATION OF MARTIAL LAWDECLARATION OF MEANS
DECLARATION OF MORTGAGEDECLARATION OF NEUTRALITY
DECLARATION OF NONBELLIGERENCYDECLARATION OF NONINFRINGEMENT
DECLARATION OF NULLITYDECLARATION OF ORIGIN
DECLARATION OF PAYMENTDECLARATION OF PERFORMANCE
DECLARATION OF PLEDGEDECLARATION OF POLICY
DECLARATION OF PRINCIPLESDECLARATION OF PRINCIPLES GOVERNING THE SEABED AND THE OCEAN FLOOR, AND THE SUBSOIL THEREOF BEYOND THE LIMITS OF NATIONAL JURISDICTION
DECLARATION OF PRIORITYDECLARATION OF PROTEST
DECLARATION OF READINESS TO PAY A DEBTDECLARATION OF READINESS TO PAY THE DEBT
DECLARATION OF RIGHTSDECLARATION OF SAFE STOWAGE
DECLARATION OF SOLVENCYDECLARATION OF SOVEREIGNTY
DECLARATION OF THE BLACK SEA ECONOMIC COOPERATIONDECLARATION OF THE ESTABLISHMENT OF THE STATE OF ISRAEL
DECLARATION OF THE POLLDECLARATION OF THE UNITED NATIONS CONFERENCE ON THE HUMAN ENVIRONMENT
DECLARATION OF THE WORLD CLIMATE CONFERENCEDECLARATION OF TITLE
DECLARATION OF TRANSSHIPMENTDECLARATION OF TRUST
DECLARATION OF VALIDITYDECLARATION OF VALUE
DECLARATION OF WARDECLARATION OF WAR AGAINST SMB
DECLARATION OF WILLDÉCLARATION OFFICIELLE
DECLARATION ON INCOMESDECLARATION ON OATH
DECLARATION ON PRINCIPLES OF INTERNATIONAL LAWDECLARATION ON RIGHTS
DECLARATION ON TERRITORIAL ASYLUMDECLARATION ON THE CONTINENTAL SHELF IN THE BALTIC SEA
DECLARATION ON THE HUMAN ENVIRONMENTDECLARATION ON THE RIGHTS OF THE CHILD
DECLARATION ONLYDECLARATION ORDER
DECLARATION OUTWARDSDECLARATION PAGE
DECLARATION PARTDECLARATION POLICY
DÉCLARATION POUR LA CONSOMMATIONDÉCLARATION PRÉLIMINAIRE
DECLARATION PRELUDEDÉCLARATION PROVISIONNELLE
DÉCLARATION PUBLIQUEDÉCLARATION RÉCAPITULATIVE
DÉCLARATION RECTIFICATIVEDÉCLARATION SIMPLE
DÉCLARATION SIMPLIFIÉEDÉCLARATION SOLENNELLE
DÉCLARATION SOMMAIREDECLARATION STATEMENT
DÉCLARATION UNILATÉRALEDÉCLARATION UNIVERSELLE DES DROITS DE L'HOMME
DÉCLARATION VERBALEDECLARATION, THE ROYAL
DECLARATIONSDECLARATIONS PAGE
DECLARATIONS SECTIONDECLARATIVE
DÉCLARATIVEDECLARATIVE ACT
DECLARATIVE INSTRUCTIONDECLARATIVE ITEM
DECLARATIVE KNOWLEDGEDECLARATIVE LANGUAGE
DECLARATIVE MEMORYDECLARATIVE OPERATION
DECLARATIVE PARTDECLARATIVE PROGRAM
DECLARATIVE REPRESENTATIONDECLARATIVE SECURITY
DECLARATIVE SENTENCEDECLARATIVE STATEMENT
DECLARATIVE THEORYDECLARATIVE THEORY OF STATEHOOD
DECLARATIVEPROCEDURAL CONTROVERSYDECLARATIVES
DECLARATIVITYDECLARATIVO
DECLARATIVUSDÉCLARATOIRE
DECLARATORDECLARATORIA
DECLARATORIA CON LUGAR DEL AMPARODECLARATORIA DE DESERCIÓN
DECLARATORIA DE HEREDEROSDECLARATORIA DE POBREZA
DECLARATORIA DE QUEBRADECLARATORIA GENERAL
DECLARATORIODECLARATORY
DECLARATORY ACTDECLARATORY ACTION
DECLARATORY COVENANTDECLARATORY EFFECT
DECLARATORY INSTRUMENTDECLARATORY JUDGEMENT
DECLARATORY JUDGEMENT ACTIONDECLARATORY JUDGMENT
DECLARATORY LAWDECLARATORY OF THE LAW
DECLARATORY PARTDECLARATORY PRECEDENT
DECLARATORY RELIEFDECLARATORY STATUTE
DECLAREDÉCLARÉ
DECLARE ... BLOCKADEDECLARE ... CONTRACT AVOIDED
DECLARE ... DIVIDENDECLARE ... DIVIDENT
DECLARE ... IDENTITYDECLARE ... INCOME
DECLARE ... LOCKOUTDECLARE ... MORATORIUM
DECLARE ... MOTION CARRIEDDECLARE ... REVERSION
DECLARE (ONESELF) AGAINST SOMEONE OR SOMETHINGDECLARE (ONESELF) FOR SOMEONE OR SOMETHING
DECLARE A BLOCKADEDECLARE A BOYCOTT
DECLARE A CANDIDATURE IN ORDERDECLARE A CANDIDATURE IRRECEIVABLE
DECLARE A CANDIDATURE OUT OF ORDERDECLARE A CANDIDATURE RECEIVABLE
DECLARE A CLAIMDECLARE A CONFLICT OF INTEREST
DECLARE A CONFLICT OF INTERESTSDECLARE A CONTRACT NULL AND VOID
DECLARE A DISASTER AREADECLARE A DISCUSSION OPEN
DECLARE A DIVIDENDDECLARE A DIVIDENT
DECLARE A LAW UNCONSTITUTIONALDECLARE A LEGAL RIGHT
DECLARE A LOCKOUTDECLARE A MARRIAGE INVALID
DECLARE A MEETING OPENDECLARE A MISTRIAL
DECLARE A MOTION CARRIEDDECLARE A MOTION IRRECEIVABLE
DECLARE A MOTION RECEIVABLEDECLARE A MUTINEER
DECLARE A RESERVATIONDECLARE A REVERSION
DECLARE A RIGHTDECLARE A STATE OF EMERGENCY
DECLARE A STATE OF EMERGENCY IN A COUNTRYDECLARE A TRUST
DECLARE A VOTE CLOSEDDECLARE A VOTE INVALID
DECLARE A VOTE TO BE FINALDECLARE A VOTE UNCONSTITUTIONAL
DECLARE ABSTENTIONSDECLARE ALLEGIANCE
DECLARE AN AGGRESSORDECLARE AN AMENDMENT IRRECEIVABLE
DECLARE AN AMENDMENT RECEIVABLEDECLARE AN AMNESTY
DECLARE AN ARTICLEDECLARE AN INTEREST
DECLARE AN INTEREST/A CONFLICT OF INTERESTDECLARE AN INTEREST/A CONFLICT OF INTERESTS
DECLARE AN INTERESTSDECLARE AN UNDESIRABLE ALIEN
DECLARE BANKRUPTDECLARE BANKRUPTCY
DECLARE CONSTITUTIONALDECLARE DETERMINATION
DECLARE DIVIDENDSDECLARE ELECTED
DECLARE ELECTION RESULTSDECLARE ELECTION RETURNS
DECLARE EQUALLY AUTHENTICDECLARE ERROR
DECLARE HANDDECLARE IDENTITY
DECLARE ILLEGALDECLARE IN
DECLARE INDEPENDENCEDECLARE INNOCENCE
DECLARE INSANEDECLARE INSOLVENCY
DECLARE INVALIDDECLARE ITSELF
DECLARE LEGALLY SANEDECLARE MARTIAL LAW
DECLARE MISSINGDECLARE MOURNING
DECLARE NOT GUILTYDECLARE NULL AND VOID
DECLARE NULLIFIEDDECLARE OFF
DECLARE ON OATHDECLARE ONE'S LOVE
DECLARE ONESELFDECLARE ONESELF BANKRUPT
DECLARE ONESELF FREE FROM THE OBLIGATIONS OF A TREATYDECLARE ONESELF INCOMPETENT
DECLARE ONESELF INSOLVENTDECLARE ONESELF THE KING
DECLARE ONESELF THE NEW KINGDECLARE ONESELF TO BE COMPETENT
DECLARE ONESELF WITHOUT JURISDICTIONDECLARE PEACE
DECLARE PERSONA NON GRATADECLARE RATIFICATION
DECLARE SMB. A MUTINEERDECLARE SMTH.
DECLARE SOLEMNLY AND SINCERELYDECLARE SOME TERRITORY A ZONE OF "VITAL INTERESTS"
DECLARE SOME TERRITORY A ZONE OF PEACEDECLARE SOVEREIGNTY
DECLARE THE BALLOT CLOSEDDECLARE THE BALLOT TO BE FINAL
DECLARE THE CONTRACT AVOIDEDDECLARE THE DIVIDENT
DECLARE THE HEARING CLOSEDDECLARE THE LIST OF SPEAKERS CLOSED
DECLARE THE POLLDECLARE THE RESULTS OF AN ELECTION
DECLARE THE STATE OF WARDECLARE TRUST
DECLARE UNCONSTITUTIONALDECLARE UNLAWFUL
DECLARE VOIDDECLARE WAR
DECLARE WAR AGAINST SOMEONE OR SOMETHINGDECLARE WAR ON
DECLARE WAR ON SOMEONE OR SOMETHINGDECLARED
DECLARED AIMDECLARED AIM OF THE REFORM
DECLARED BANKRUPTCYDECLARED BY STATUTE
DECLARED CAPABILITYDECLARED CAPITAL
DECLARED COMMITMENTSDECLARED CONDITIONS
DECLARED DISTANCEDECLARED DIVIDEND
DECLARED DIVIDENDSDECLARED EARNINGS
DECLARED EXECUTORYDECLARED IN DEFAULT
DECLARED INCOMEDECLARED INSOLVENCY
DECLARED NOT TO HAVE BEEN COMPLETEDDECLARED NOT TO HAVE BEEN HELD
DECLARED NOT TO HAVE OCCURED (BEEN HELD, TAKEN PLACE, BEEN COMPLETED)DECLARED NOT TO HAVE OCCURRED
DECLARED NOT TO HAVE TAKEN PLACEDECLARED RESERVE
DECLARED RESERVESDECLARED SHORTAGE
DECLARED SPEEDDECLARED STATE OF WAR
DECLARED STOCKSDECLARED SYMBOL
DECLARED TEMPERATUREDECLARED VALUE
DECLARED WARDECLAREE
DÉCLARÉEDECLAREE SIGNATURE
DECLARERDÉCLARER
DÉCLARER FORFAITDECLAREREN
DECLARESDECLARING
DECLARING A BLOCKADEDECLARING BANKRUPT
DECLARING BODILY INJURY CLAIMDECLARING IDENTITY
DECLARING NULL AND VOIDDECLARING PARTY
DECLARING SOLEMNLY AND SINCERELYDECLARING THE CONTRACT AVOIDED
DECLARODECLASA
DECLASATDECLASS
DECLASSAMENTODECLASSARE
DECLASSARE UN IMPIEGATODECLASSATO
DECLASSEDECLASSÉ
DÉCLASSÉDECLASSE FR.
DECLASSEDDECLASSED ELEMENTS
DÉCLASSÉEDÉCLASSEMENT
DÉCLASSERDECLASSEREN
DÉCLASSÉSDÉCLASSÉS TROP GRANDS
DÉCLASSÉS TROP PETITSDECLASSIFICARE
DECLASSIFICATIONDÉCLASSIFICATION
DECLASSIFICATION OF DATADECLASSIFICATION OF DOCUMENTS
DECLASSIFICATION OF REPORTDECLASSIFIED
DECLASSIFIED INVENTIONDECLASSIFIEDFY
DECLASSIFIESDECLASSIFY
DECLASSIFYINGDÉCLAVETER
DECLBDÉCLENCHANT
DÉCLENCHEDÉCLENCHEMENT
DÉCLENCHEMENT DE L'ACCOUCHEMENTDÉCLENCHEMENT DE LA PROCÉDURE
DÉCLENCHEMENT DE LA PROTECTION DIPLOMATIQUEDÉCLENCHEMENT DE LA RÉACTION
DÉCLENCHEMENT DE LA TURBULENCEDÉCLENCHEMENT DE POURSUITE
DÉCLENCHEMENT DES HOSTILITÉSDÉCLENCHEMENT DIFFÉRÉ
DÉCLENCHEMENT DU BRÛLEURDÉCLENCHEMENT DU TRAVAIL
DÉCLENCHEMENT ÉMOTIONNELDÉCLENCHEMENT INSTANTANÉ
DÉCLENCHEMENT MONOCOURSEDÉCLENCHEMENT PÉRIODIQUE
DÉCLENCHEMENT RÉACTIONNELDÉCLENCHEMENT RETARDÉ
DÉCLENCHEMENT UNIPOLAIREDÉCLENCHER
DÉCLENCHER LA GUERREDÉCLENCHEUR
DÉCLENCHEUR À ACTION DIFFÉRÉEDÉCLENCHEUR À COÏNCIDENCE
DÉCLENCHEUR À RETARDEMENTDÉCLENCHEUR AUTOMATIQUE
DÉCLENCHEUR DE SÛRETÉDÉCLENCHEUR DE SURVITESSE
DÉCLENCHEUR FLEXIBLEDÉCLENCHEUR SOUPLE
DÉCLENCHEUR TEMPORISÉDÉCLENCHEUR THERMIQUE
DÉCLENCHEUR THERMONUCLÉAIREDECLENSION
DECLENSIONALDECLENSIONAL ENDINGS
DECLENSIONSDÉCLÉRICALISATION
DÉCLÉRICALISERDECLERICALIZATION
DECLGDECLIC
DÉCLICDECLIN
DÉCLINDÉCLIN DE FLUORESCENCE
DÉCLIN DE LA FLUORESCENCEDÉCLIN ÉCONOMIQUE
DECLINADECLINABIL
DECLINABILEDECLINABILIS
DECLINABILITYDECLINABLE
DÉCLINABLEDECLINAÇÃO
DECLINACIÓNDECLINACIÓN F DE PRETENCIÓN
DECLINACIÓN GRADUALDECLINADOR
DÉCLINAISONDÉCLINAISON MAGNÉTIQUE
DÉCLINANTDECLINANTE
DÉCLINANTEDECLINAR
DECLINAR LA RESPONSABILIDADDECLINAR OS OLHOS
DECLINAREDECLINARE IL PROPRIO NOME
DECLINARE LA COMPETENZADECLINARE LA GIURISDIZIONE
DECLINARE UN INVITODECLINATE
DÉCLINATEURDECLINATIE
DECLINĂŢIEDECLINATIO
DECLINATIONDÉCLINATION
DECLINATION ANGLEDECLINATION ARC
DECLINATION AXISDECLINATION CIRCLE
DECLINATION COMPASSDECLINATION DIAGRAM
DECLINATION NEEDLEDECLINATION OF FEVER
DECLINATION OF NEEDLEDECLINATION OF STAR
DECLINATION OF THE ZENITHDECLINATION VARIOMETER
DECLINATION VERNIERDECLINATIONS
DÉCLINATOIREDÉCLINATOIRE CONNEXITÉ
DÉCLINATOIRE DE COMPÉTENCEDÉCLINATOIRE DE COMPÉTENCE ARBITRALE
DÉCLINATOIRE DE LITISPENDANCEDECLINATOR
DECLINATOREDECLINATORIA
DECLINATORIA DE JURISDICCIÓNDECLINATORIO
DECLINATÓRIODECLINATORIU
DECLINATORYDECLINATORY EXCEPTION
DECLINATUREDECLINATUS
DECLINÁVELDECLINAZIONE
DECLINAZIONE A DESTRADECLINAZIONE A SINISTRA
DECLINAZIONE ASSOLUTADECLINAZIONE ASTRONOMICA
DECLINAZIONE AUSTRALEDECLINAZIONE BOREALE
DECLINAZIONE DEL SOLEDECLINAZIONE MAGNETICA
DECLINAZIONE OCCIDENTALEDECLINAZIONE ORIENTALE
DECLINEDECLINE ... CLAIMANT'S DEMAND
DECLINE 3 POINTSDECLINE A CASE
DECLINE A COMPLAINTDECLINE A NOMINATION
DECLINE A PROPOSALDECLINE A PROTEST
DECLINE AN INVITATIONDECLINE AN OFFER
DECLINE CENTERRIGHT PARTIESDECLINE CURVE
DECLINE CURVESDECLINE IN BUSINESS ACTIVITY
DECLINE IN CONSUMPTIONDECLINE IN CRIME
DECLINE IN DOLLARDECLINE IN ECONOMIC ACTIVITY
DECLINE IN EMPLOYMENTDECLINE IN EXCHANGE RATE
DECLINE IN FOREIGN INVESTMENTDECLINE IN INTEREST RATE
DECLINE IN JOBSDECLINE IN LAKE LEVEL
DECLINE IN LIVING STANDARDSDECLINE IN LOCAL CRUDE OIL PRODUCTION
DECLINE IN OIL REVENUESDECLINE IN OUTPUT
DECLINE IN POPULATIONDECLINE IN PRICES
DECLINE IN PRODUCTIONDECLINE IN PRODUCTION OF THE WELL
DECLINE IN PROFITSDECLINE IN PURCHASING POWER
DECLINE IN QUOTATIONSDECLINE IN RATES
DECLINE IN REAL INCOMEDECLINE IN REAL WAGES
DECLINE IN SALESDECLINE IN SPENDING
DECLINE IN THE CRIME RATEDECLINE IN THE DOLLAR
DECLINE IN THE LEVEL OF MILITARY CONFRONTATIONDECLINE IN THE LIVING STANDARD
DECLINE IN THE VOLUME OF EXPORTSDECLINE IN TRADE
DECLINE IN TRANSMISSIONDECLINE IN TURNOVER
DECLINE IN UNEMPLOYMENTDECLINE IN VALUE
DECLINE JURISDICTIONDECLINE LINE
DECLINE OF A CURRENCYDECLINE OF A WELL
DECLINE OF AN AUTHORISATION REQUESTDECLINE OF ART
DECLINE OF BIRTHDECLINE OF EXPORT MARKETS
DECLINE OF FORESTSDECLINE OF GAS SUPPLY
DECLINE OF GROWTH RATESDECLINE OF INFLUENCE
DECLINE OF MORALITYDECLINE OF PIESOMETRIC SURFACE
DECLINE OF PRODUCTIONDECLINE OF SORPTION CAPACITY
DECLINE OF SUPPORTDECLINE OF THE AUTHORISATION REQUEST
DECLINE OF THE MOONDECLINE OF THE WEST
DECLINE OF UNDERGROUND WATER LEVELDECLINE OF WATER TABLE
DECLINE OF WELLDECLINE ONE'S HEAD ON ONE'S BREAST
DECLINE PERIODDECLINE PERIOD OF WATER TABLE
DECLINE PHASEDECLINE RATE
DECLINE STAGEDECLINE TO ANSWER QUESTIONS
DECLINE TO GIVE EVIDENCEDECLINE TO TAKE PART IN A MEETING
DECLINE WITH THE DEPTHDECLINED
DECLINED GRAPTOLITESDECLINED WELL
DECLINED WITH THE DEPTHDÉCLINEMENT
DECLINERDÉCLINER
DÉCLINER SON NOMDECLINEREN
DECLINERSDECLINES
DECLININGDECLINING AUTHORITY
DECLINING BALANCEDECLINING BALANCE DEPRECIATION
DECLINING BALANCE DEPRECIATION METHODDECLINING BALANCE METHOD
DECLINING BALANCES METHODDECLINING BLOCK RATE
DECLINING COMPRESSIONDECLINING DEMAND
DECLINING FAMILYDECLINING INDUSTRY
DECLINING MARGINAL EFFICIENCY OF CAPITAL THEORYDECLINING MARGINAL UTILITY
DECLINING MARKETDECLINING MILITARY BUDGET
DECLINING PHASEDECLINING POPULATION
DECLINING PRODUCTDECLINING PRODUCTION
DECLINING RATE OF PROFITDECLINING SALES TREND
DECLINING SECTOR OF THE ECONOMYDECLINING SECTORS OF THE ECONOMY
DECLINING SECURITY SITUATIONDECLINING SHARE
DECLINING SHARESDECLINING STAGE
DECLINING STANDDECLINING STOCKS
DECLINING SUPERPOWERDECLINING THE INTERNATIONAL APPLICATION UNDER THE TRT
DECLINING TO GIVE EVIDENCEDECLINING VALUE OF THE DOLLAR
DECLINING WITH THE DEPTHDECLINING YEARS
DECLININGBALANCE DEPRECIATIONDECLININGBALANCE METHOD OF DEPRECIATION
DECLINISDECLINISM
DECLINODECLINO DEI PREZZI
DECLINO DEL MERCATODECLINO DELLE VENDITE
DECLINOGRAFODECLINOGRAPH
DECLINOMETERDÉCLINOMÈTRE
DECLINOMETRODÉCLIQUER
DÉCLIQUETAGEDÉCLIQUETER
DECLIVEDÉCLIVE
DECLIVIDADDECLIVIO
DECLIVIO LATERALEDECLIVIO STABILE
DECLIVIOUSDECLIVIS
DECLIVITÀDECLIVITAS
DECLIVITATEDÉCLIVITÉ
DECLIVITIESDECLIVITOUS
DECLIVITYDECLIVITY ANGLE
DECLIVODECLIVOSO
DECLIVOUSDECLIVUM
DECLOGDECLOGGED
DECLOGGINGDÉCLOISONNEMENT
DÉCLOISONNERDECLOMYCIN
DÉCLOMYCINEDECLORARE
DECLORAZIONEDÉCLORE
DECLORURATODECLORURAZIONE
DÉCLOUERDECLUCHING
DECLUSTERDECLUSTERED
DECLUTCHDECLUTCHED
DECLUTCHINGDECLUTCHING LEVER
DECLUTTERDECM
DECMSDECMSTATION
DECNDECNET
DECNET SOFTWAREDECO
DÉCODECO HOTEL FLORENCE (FLORENCE)
DECOADADECOAGULANT
DÉCOAGULATIONDÉCOAGULER
DECOARDECOATING
DECOBALTDECOBALTIFICATION
DECOBALTIFLCATIONDECOCÇÃO
DECOCCIÓNDÉCOCHAGE
DÉCOCHEMENTDÉCOCHER
DÉCOCHER DES POINTESDÉCOCHER UN TRAIT
DECOCKERDECOCKING LEVER
DECOCODÉCOCONNAGE
DÉCOCONNERDECOCOON
DECOCTDECOCTA
DÉCOCTÉDECOCTED
DECOCŢIEDECOCTING
DECOCTIODECOCTION
DÉCOCTIONDÉCOCTION DE COUPS DE BÂTON
DÉCOCTION DE GROS SOUSDECOCTION OF CINCHONA
DECOCTIONSDECOCTO
DECOCTORDECOCTS
DECOCTUMDECOCTUM LYCOPODII SELAGINOSI
DECOCTUM, I NDECOCTUS
DECODABILITYDECODABLE
DÉCODAGEDÉCODAGE À MAXIMUM DE VRAISEMBLANCE
DÉCODAGE DE LETTRE DE FONCTIONDÉCODAGE MAJORITAIRE
DÉCODAGE PAR COÏNCIDENCESDECODE
DECODE ... MESSAGEDECODE A MESSAGE
DECODE ADDRESSDECODE CIRCUIT
DECODE KEYDECODED
DECODED MESSAGEDECODED OPERATION
DECODED OUTPUTDECODED RELATION
DECODED SIGNALDECODED VALUE
DECODED VOICEDECODEMENT
DECODERDÉCODER
DECODER CIRCUITDECODER CONNECTOR
DECODER MATRIXDECODER NETWORK
DECODER SWITCHDECODER SYNTHESIZER
DECODER/DRIVERDECODEREN
DECODERSDECODES
DÉCODEURDÉCODEUR COULEUR
DÉCODEUR D'ADRESSEDÉCODEUR DE FONCTION
DÉCODEUR OPTOÉLECTRONIQUEDÉCODEURBASCULEUR
DÉCODEURSÉLECTEURDÉCODEUSE
DECODIERENDECODIERER
DECODIERUNGDECODIFICA
DECODIFICACIONDECODIFICACIÓN
DECODIFICADORDECODIFICAR
DECODIFICAREDÉCODIFICATEUR
DECODIFICATIONDÉCODIFICATION
DECODIFICATOREDECODIFICATORE DELLE ISTRUZIONI
DECODIFICATORE DI INDIRIZZODECODIFICATORE DI OPERAZIONE
DECODIFICATORE DI OPERAZIONIDECODIFICATORE MATRICIALE
DECODIFICATORE NUMERICODECODIFICATORE OPTOELETTRONICO
DECODIFICAZIONEDECODIFICAZIONE ADATTIVA
DECODIFICAZIONE OLOGRAFICADECODIFICAZIONE PARALLELA
DECODIFICAZIONE PROBABILISTICADECODIFICAZIONE SEQUENZIALE
DECODINGDECODING ALGORITHM
DECODING CARDDECODING CIRCUIT
DECODING DEVICEDECODING ERROR
DECODING FILTERDECODING FUNCTION
DECODING GATEDECODING LOGIC
DECODING MATRIXDECODING NETWORK
DECODING PRINCIPLESDECODING PROBLEM
DECODING PROCEDUREDECODING PROCESS
DECODING RELAYDECODING SCHEME
DECODING SELECTION SYSTEMDECODING SITE
DECODING SYSTEMDECODING TABLE
DECODING TRELLISDECODING WINDOW
DECODINGTIME STAMPDECOESIONE
DÉCOFFRAGEDÉCOFFRER
DECOFRADECOFRARE
DECOHEREDÉCOHÉRENCE
DECOHERERDÉCOHÉRER
DECOHERIZZATOREDÉCOHÉSION
DECOHESIVE RUPTUREDÉCOIFFAGE
DÉCOIFFEMENTDÉCOIFFER
DÉCOIFFER SAINT PIERRE POUR COIFFER SAINT PAULDÉCOIFFER SAINTE CATHERINE
DÉCOIFFER UNE BOUTEILLEDECOILER
DECOILER ROLLDECOILER TENSION
DECOILINGDECOILING EQUIPMENT
DECOILING LINEDECOILING MACHINE
DECOIN, HENRIDÉCOINÇAGE
DÉCOINCEMENTDÉCOINCER
DÉCOINCEUR DE ROBINETSDÉCOÏQUE
DÉCOKAGEDECOKE
DECOKINGDECOKING OF THE CATALYST
DECOLDECOLA
DECOLAGEMDECOLAJE
DECOLARDECOLARE
DÉCOLÉRERDECOLLAGE
DÉCOLLAGEDÉCOLLAGE COURT
DÉCOLLAGE DE L'ARMATUREDÉCOLLAGE SUR ALERTE
DECOLLAGENIZATIONDECOLLAGGIO
DECOLLAGIODECOLLAGIST
DECOLLAGISTINDECOLLAJE
DECOLLARDECOLLARE
DECOLLATEDECOLLATED
DÉCOLLATEURDECOLLATING
DECOLLATIODECOLLATION
DÉCOLLATIONDECOLLATOR
DECOLLAZIONEDÉCOLLÉ
DÉCOLLECTIVISERDÉCOLLÉE
DECOLLEMENTDÉCOLLEMENT
DÉCOLLEMENT COLOÉPIPLOÏQUEDÉCOLLEMENT DE CHOC
DÉCOLLEMENT DE COMPRESSIBILITÉDÉCOLLEMENT DE L'ÉMULSION
DÉCOLLEMENT DE LA FLAMMEDÉCOLLEMENT DE LA GENCIVE
DÉCOLLEMENT DE MOULAGEDÉCOLLEMENT DU PLACENTA
DÉCOLLEMENT DUODÉNOPANCRÉATIQUEDÉCOLLEMENT ÉPIPHYSAIRE
DECOLLEMENT FOLDDÉCOLLEMENT LAMINAIRE
DÉCOLLEMENT MANUEL DE PLACENTADÉCOLLEMENT PÉRICARDIQUE
DÉCOLLEMENT PRÉMATURÉ DU PLACENTADÉCOLLEMENT TURBULENT
DÉCOLLERDÉCOLLER LE BILLARD
DÉCOLLER LE CIGAREDÉCOLLER SES FESSES
DECOLLETAGEDÉCOLLETAGE
DECOLLETEDÉCOLLETÉ
DÉCOLLETÉ DORSALDECOLLETE FR.
DECOLLETEEDÉCOLLETÉE
DÉCOLLETERDÉCOLLETEUR
DÉCOLLETEUSEDÉCOLLEUR
DÉCOLLEUSEDECOLLO
DECOLLO CATAPULTATODECOLLO DELL'ECONOMIA
DECOLLO STRUMENTALEDECOLLO VERTICALE
DÉCOLMATAGEDÉCOLMATAGE DES MANCHES
DÉCOLMATAGE DES PAROIS DE FILTRATIONDECOLO
DECOLONIALIZATIONDECOLONIALIZATION PROCESS
DECOLONISATIONDÉCOLONISATION
DÉCOLONISERDÉCOLONISÉS
DECOLONIZATIONDECOLONIZATION PROCESS
DECOLONIZEDECOLONIZZARE
DECOLONIZZAZIONEDECOLOR
DECOLORĂDECOLORACIÓN
DECOLORANTDÉCOLORANT
DECOLORANTEDÉCOLORANTE
DECOLORARDECOLORARE
DECOLORATDECOLORATE
DECOLORATE IDECOLORATE II
DECOLORATIODECOLORATION
DÉCOLORATIONDÉCOLORATION À SEC
DÉCOLORATION DES EFFLUENTSDÉCOLORATION DES MATIÈRES
DÉCOLORATION DES POILSDÉCOLORATION PAR LES VAPEURS
DÉCOLORATION THERMIQUEDECOLORATO
DECOLORAZIONEDÉCOLORÉ
DÉCOLORÉEDÉCOLORER
DECOLORIMETERDECOLORIZATION
DECOLORIZEDECOLORIZE AGENT
DECOLORIZE CELLULOSEDECOLORIZE OIL
DECOLORIZEDDECOLORIZER
DECOLORIZINGDECOLORIZING AGENT
DECOLORIZING CARBONDECOLORO
DECOLORUSDECOLOUR
DECOLOURANTDECOLOURATION
DECOLOURISEDECOLOURISER
DECOLOURIZATIONDECOLOURIZE
DECOLOURIZEDDECOLOURIZING
DECOLOURIZING CARBONDECOLOURIZING CHAR
DECOLTADECOLTAT
DECOLTEUDECOMANDA
DECOMBENTEDECOMBERE
DECOMBRE, AMBROISEDÉCOMBRER
DÉCOMBRESDECOMEDES, S.
DECOMETERDECOMISABLE
DECOMISARDECOMISO
DECOMMDÉCOMMANDER
DÉCOMMETTREDECOMMISSION
DECOMMISSIONEDDECOMMISSIONED PIPELINE
DECOMMISSIONINGDECOMMISSIONING (OF OVERHEAD/OVERGROUND ELECTRIC CABLES)
DECOMMISSIONING COSTDECOMMISSIONING COSTS
DECOMMISSIONING EXPERT GROUPDECOMMISSIONING FUND TRUSTEE
DECOMMISSIONING OF NUCLEAR INSTALLATIONSDECOMMISSIONING OF WEAPONS
DECOMMISSIONING WASTEDECOMMUNISATION
DECOMMUTATIONDECOMMUTATION EQUIPMENT
DECOMMUTATION GROUND STATIONDECOMMUTATOR
DECOMPDECOMP.
DÉCOMPACTERDECOMPACTION
DECOMPARTMENTALIZATIONDECOMPD.
DECOMPENSATEDECOMPENSATED
DECOMPENSATED ACIDOSISDECOMPENSATED CIRRHOSIS
DECOMPENSATED DIABETESDECOMPENSATED GLAUCOMA
DECOMPENSATED HEMOLYSISDECOMPENSATED HEMORRHAGE
DECOMPENSATED HETEROPHORIADECOMPENSATION
DÉCOMPENSATIONDÉCOMPENSATION DE L'ÉTAT NEUROLOGIQUE
DÉCOMPENSATION DES CAVITÉS PYÉLOCALICIELLESDÉCOMPENSÉ
DÉCOMPENSÉEDÉCOMPENSER
DECOMPILATIONDÉCOMPILATION
DECOMPILEDECOMPILER
DECOMPILINGDECOMPLEMENTATION
DECOMPLEMENTIZEDÉCOMPLÉTER
DECOMPLEXDÉCOMPLEXATION
DÉCOMPLEXÉDÉCOMPLEXÉE
DÉCOMPLEXERDECOMPN.
DECOMPONENTEDECOMPONIBILE
DECOMPONIBILITÀDECOMPONÍVEL
DECOMPORDECOMPORRE
DECOMPORSEDECOMPORSI
DÉCOMPOSABILITÉDECOMPOSABILITY
DECOMPOSABLEDÉCOMPOSABLE
DECOMPOSABLE AUTOMATONDECOMPOSABLE AUTOMORPHISM
DECOMPOSABLE BUNDLEDECOMPOSABLE CHAIN
DECOMPOSABLE CHANNELDECOMPOSABLE CODE
DECOMPOSABLE CURVEDECOMPOSABLE DISTRIBUTION
DECOMPOSABLE ELEMENTDECOMPOSABLE EVENT
DECOMPOSABLE FORMDECOMPOSABLE FORMULA
DECOMPOSABLE FUNCTIONDECOMPOSABLE GAME
DECOMPOSABLE GENERATORDECOMPOSABLE GRAPH
DECOMPOSABLE GROUPDECOMPOSABLE IDEAL
DECOMPOSABLE MATRIXDECOMPOSABLE MODEL
DECOMPOSABLE MODULEDECOMPOSABLE OPERATION
DECOMPOSABLE OPERATORDECOMPOSABLE ORGANIC MATTER
DECOMPOSABLE PENCILDECOMPOSABLE POLYNOMIAL
DECOMPOSABLE POLYTOPEDECOMPOSABLE PROCESS
DECOMPOSABLE REPRESENTATIONDECOMPOSABLE SEQUENCE
DECOMPOSABLE STATISTICSDECOMPOSABLE SYSTEM
DECOMPOSABLE TENSORDECOMPOSABLE TRELLIS
DECOMPOSABLE VARIETYDECOMPOSABLE VECTOR
DECOMPOSABLE ZERODÉCOMPOSANT
DÉCOMPOSANTEDECOMPOSE
DÉCOMPOSÉDECOMPOSE A FORCE
DECOMPOSE A FORCE INTO COMPONENTSDECOMPOSE EUTECTOIDALLY
DECOMPOSEDDECOMPOSED BODY
DECOMPOSED CHAINDECOMPOSED COAL
DECOMPOSED CONDITIONDECOMPOSED CURVE
DECOMPOSED DUNGDECOMPOSED FUEL
DECOMPOSED IDEALDECOMPOSED LIMESTONE
DECOMPOSED LINEDECOMPOSED MANURE
DECOMPOSED ORGANIC MATTERDECOMPOSED OUTCROP
DECOMPOSED PRIMEDECOMPOSED ROCK
DÉCOMPOSÉEDECOMPOSER
DÉCOMPOSERDECOMPOSERS
DECOMPOSESDÉCOMPOSEUR
DECOMPOSIÇÃODECOMPOSING
DECOMPOSING COATINGDECOMPOSING COMPOUND
DECOMPOSING FUNCTIONDECOMPOSING FURNACE
DECOMPOSING MAPPINGDECOMPOSING POT
DECOMPOSING REGIMEDECOMPOSING REMAINS
DECOMPOSING SOLID SOLUTIONDECOMPOSITE
DECOMPOSITIONDÉCOMPOSITION
DECOMPOSITION (OF THE CONTRACT)DÉCOMPOSITION 1
DÉCOMPOSITION 2DECOMPOSITION AGENT
DECOMPOSITION ALGORITHMDÉCOMPOSITION ANAÉROBIQUE
DÉCOMPOSITION ANODIQUEDÉCOMPOSITION BIOLOGIQUE
DECOMPOSITION BY FUNGIDECOMPOSITION BY THE LEVELS OF CONTROL
DECOMPOSITION BY THE LEVELS OF INFLUENCEDECOMPOSITION CATALYST
DÉCOMPOSITION CATALYTIQUEDECOMPOSITION CHAMBER
DÉCOMPOSITION CHIMIQUEDÉCOMPOSITION COMPLÈTE
DÉCOMPOSITION D'UN VECTEURDÉCOMPOSITION DE CORIOLIS
DÉCOMPOSITION DE L'HUILEDÉCOMPOSITION DE LA VAPEUR
DÉCOMPOSITION DES MOUVEMENTSDECOMPOSITION DIAMETER
DÉCOMPOSITION DOUBLEDÉCOMPOSITION DU NIVEAU
DÉCOMPOSITION DU TRAVAILDÉCOMPOSITION ÉLECTROLYTIQUE
DÉCOMPOSITION EN DOUBLETDÉCOMPOSITION EN MULTIPLET
DÉCOMPOSITION EN PHASES SIMPLESDÉCOMPOSITION EN SÉRIE DE FOURIER
DECOMPOSITION ENDOMORPHISMDÉCOMPOSITION EUTECTIQUE
DÉCOMPOSITION EXPLOSIVEDECOMPOSITION FIELD
DECOMPOSITION FORMULADECOMPOSITION GASES
DÉCOMPOSITION GRANULOMÉTRIQUEDECOMPOSITION GROUP
DECOMPOSITION HEATDÉCOMPOSITION HÉTÉROLYTIQUE
DÉCOMPOSITION HOMOLYTIQUEDÉCOMPOSITION HYDROLYTIQUE
DÉCOMPOSITION HYPERFINEDECOMPOSITION IN SPACE
DECOMPOSITION IN TIMEDECOMPOSITION INHIBITOR
DÉCOMPOSITION IONIQUEDECOMPOSITION LEVEL
DECOMPOSITION MAJORANTDECOMPOSITION MATRIX
DECOMPOSITION METHODDECOMPOSITION NUMBER
DECOMPOSITION OF A FRACTIONDECOMPOSITION OF CAPITAL
DECOMPOSITION OF DISLOCATIONDECOMPOSITION OF FETUS
DECOMPOSITION OF FRACTIONDECOMPOSITION OF GRAPH
DECOMPOSITION OF HANDICRAFTDECOMPOSITION OF INTERVAL
DECOMPOSITION OF IRON CARBIDEDECOMPOSITION OF LABORPROCESS
DECOMPOSITION OF LABOURDECOMPOSITION OF MOVEMENT
DECOMPOSITION OF ORGANIC MATTERDECOMPOSITION OF PERLITE (PEARLITE)
DECOMPOSITION OF PROCESS OF PRODUCTIONDECOMPOSITION OF VECTOR
DECOMPOSITION ON THE BASIS OF STRUCTUREDÉCOMPOSITION OXYDATIVE
DÉCOMPOSITION PAR LA CHALEURDÉCOMPOSITION PAR RAYONNEMENT
DÉCOMPOSITION PARTIELLEDÉCOMPOSITION PÉRITECTIQUE
DÉCOMPOSITION PHOTOCHIMIQUEDÉCOMPOSITION PHOTOSENSIBILISÉE
DECOMPOSITION PLANNINGDECOMPOSITION POINT
DECOMPOSITION POTENTIALDECOMPOSITION PRODUCT
DECOMPOSITION PRODUCTSDÉCOMPOSITION PUTRIDE
DÉCOMPOSITION PYROGÉNÉEDÉCOMPOSITION PYROLYTIQUE
DÉCOMPOSITION QUADRIPOLAIREDÉCOMPOSITION RADIOLYTIQUE
DECOMPOSITION REACTIONDECOMPOSITION REACTION METHOD
DECOMPOSITION REAСTIONDECOMPOSITION SCHEME
DECOMPOSITION SPACEDÉCOMPOSITION SPECTRALE
DÉCOMPOSITION SPINODALEDÉCOMPOSITION SPONGIEUSE
DÉCOMPOSITION SPONTANÉEDÉCOMPOSITION STRICTEMENT CROISSANTE
DÉCOMPOSITION STRICTEMENT DÉCROISSANTEDECOMPOSITION SUBGROUP
DECOMPOSITION TECHNIQUEDECOMPOSITION TEMPERATURE
DECOMPOSITION THEOREMDECOMPOSITION THEORY
DÉCOMPOSITION THERMIQUEDÉCOMPOSITION TOTALE
DECOMPOSITION TREEDÉCOMPOSITION TRICHROMATIQUE
DECOMPOSITION VALUEDECOMPOSITION VOLTAGE
DECOMPOSITIONREJECTION TECHNIQUEDECOMPOSITIONS
DECOMPOSIZIONEDECOMPOSIZIONE CATALITICA
DECOMPOSIZIONE CHIMICADECOMPOSIZIONE DEL LUBRIFICANTE
DECOMPOSIZIONE DEL VETTOREDECOMPOSIZIONE DELLA DISLOCAZIONE
DECOMPOSIZIONE DI FOURIERDECOMPOSIZIONE ELETTROLITICA
DECOMPOSIZIONE EUTETTICADECOMPOSIZIONE EUTETTOIDE
DECOMPOSIZIONE FOTOCHIMICADECOMPOSIZIONE IDROLITICA
DECOMPOSIZIONE ISOTERMICADECOMPOSIZIONE PIROGENICA
DECOMPOSIZIONE RADIOLITICADECOMPOSIZIONE SENSIBILIZZATA
DECOMPOSIZIONE SPETTRALEDECOMPOSIZIONE SPONTANEA
DECOMPOSIZIONE TERMICADECOMPOSIZIONE TOTALE
DECOMPOSTODECOMPOUND
DECOMPOUND LEAFDECOMPOUNDABLE
DECOMPOUNDEDDECOMPOZABILITY
DECOMPRESSDECOMPRESSED
DÉCOMPRESSERDECOMPRESSES
DÉCOMPRESSEURDÉCOMPRESSIMÈTRE
DECOMPRESSINGDECOMPRESSION
DÉCOMPRESSIONDECOMPRESSION BAROTRAUMA
DECOMPRESSION CHAMBERDECOMPRESSION CHAMBER COMMUNICATION AIDS
DECOMPRESSION CHAMBER ROOMDÉCOMPRESSION CHIRURGICALE
DECOMPRESSION DISEASEDECOMPRESSION ILLNESS
DECOMPRESSION ILLNESS DECOMPRESSION INJURY DECOMPRESSION SICKNESSDECOMPRESSION INJURY
DECOMPRESSION LAMINECTOMYDECOMPRESSION MYOTOMY
DECOMPRESSION OF HEARTDECOMPRESSION OF PERICARDIUM
DECOMPRESSION OF RECTUMDECOMPRESSION PARALYSIS
DÉCOMPRESSION PORTALE GLOBALEDÉCOMPRESSION PORTALE HYPERSÉLECTIVE
DÉCOMPRESSION PORTALE RÉGIONALEDECOMPRESSION PROTECTION
DÉCOMPRESSION RADICALAIREDECOMPRESSION SICKNESS
DECOMPRESSION SLEEVEDECOMPRESSION SPHERE
DECOMPRESSION STOPDECOMPRESSION TABLE
DECOMPRESSION TANKDECOMPRESSION VALVE
DECOMPRESSION ZONEDECOMPRESSIONE
DECOMPRESSIONE CRANICADECOMPRESSIONE ESPLOSIVA
DECOMPRESSIONSDECOMPRESSIVE CRANIOTOMY
DECOMPRESSIVE FACSIOTOMYDECOMPRESSIVE TREPANATION
DECOMPRESSIVE TREPANATION OF THE SKULLDECOMPRESSOR
DECOMPRESSOREDECOMPRESSORS
DÉCOMPRIMERDECOMPRIMERE
DÉCOMPTAGEDÉCOMPTE
DÉCOMPTE DES BULLETINSDÉCOMPTE DES LIGNES
DÉCOMPTE DES VOIXDÉCOMPTE DU DÉLAI
DÉCOMPTERDECON
DECON OPERATOR LENGTHDÉCON.
DECONCENTRAREDECONCENTRARSI
DECONCENTRATEDECONCENTRATION
DÉCONCENTRATIONDECONCENTRATO
DECONCENTRATORDECONCENTRAZIONE
DÉCONCENTRÉDÉCONCENTRER
DECONCERTADECONCERTANT
DÉCONCERTANTDÉCONCERTANTE
DECONCERTATDÉCONCERTÉ
DÉCONCERTERDECONCILIO
DECONDENSATIONDECONDENSATION OF CHROMOSOMES
DECONDENSEDDECONDITION
DECONDITIONED CREWDECONDITIONED STATE
DECONDITIONINGDÉCONDITIONNEMENT
DÉCONDITIONNERDECONDIZIONARE
DECONDODECONECTA
DECONECTAREDÉCONFÈS
DÉCONFESSIONNALISATIONDÉCONFESSIONNALISER
DÉCONFIREDÉCONFIT
DÉCONFITEDÉCONFITURE
DECONFLICTDECONGELAMENTO
DECONGELAREDÉCONGÉLATION
DÉCONGÉLATION DIÉLECTRIQUEDECONGELAZIONE
DÉCONGELERDÉCONGÉLER
DECONGESTDECONGESTANT
DÉCONGESTIFDECONGESTING
DECONGESTING THE URBAN AREASDECONGESTION
DÉCONGESTIONDECONGESTIONAMENTO
DECONGESTIONANTE NASALEDECONGESTIONARE
DECONGESTIONEDÉCONGESTIONNEMENT
DÉCONGESTIONNERDECONGESTIVE
DÉCONGESTIVEDÉCONJUGAISON
DECONJUGATIONDÉCONNAGE
DÉCONNECTERDÉCONNECTEUR
DÉCONNECTIONDÉCONNER
DÉCONNER À PLEINS TUBESDÉCONNEXION
DÉCONNEXION AZYGOPORTALEDÉCONOPHONE
DECONSECRATEDECONSECRATION
DECONSECRATION OF DIVORCEDECONSECRATION OF LUNACY
DÉCONSEILLÉDÉCONSEILLER
DECONSERVATED SPACE STATIONDÉCONSIDÉRATION
DÉCONSIDÉRERDÉCONSIGNE
DÉCONSIGNERDECONSOLIDATION
DÉCONSOLIDATIONDECONSTITUTIONALIZATION
DÉCONSTITUTIONNALISATIONDECONSTRUCT
DECONSTRUCTIONDÉCONSTRUCTION
DECONSTRUCTION AND DERRIDADECONSTRUCTIONISM
DECONSTRUCTIONISTDECONSTRUCTIVE
DECONSTRUCTIVISMDECONSTRUCTOR
DÉCONSTRUIREDECONT
DECONTADECONTAMINACIÓN
DECONTAMINANTDÉCONTAMINANT
DECONTAMINARDECONTAMINARE
DECONTAMINATEDECONTAMINATED
DECONTAMINATED WATERDECONTAMINATES
DECONTAMINATINGDECONTAMINATING AGENT
DECONTAMINATING APPARATUSDECONTAMINATING EQUIPMENT
DECONTAMINATING RECIPEDECONTAMINATING SOLUTION
DECONTAMINATING STEAM MIXTUREDECONTAMINATION
DÉCONTAMINATIONDECONTAMINATION AGENT
DECONTAMINATION APPARATUSDECONTAMINATION AREA
DECONTAMINATION BY DIPPINGDECONTAMINATION CELL
DECONTAMINATION CENTREDECONTAMINATION CENTRE DECONTAMINATION STATION
DECONTAMINATION CHAMBERDECONTAMINATION CHARACTERISTIC
DECONTAMINATION COLUMNDECONTAMINATION CYCLE
DÉCONTAMINATION DE LIQUIDEDÉCONTAMINATION DES DÉCHETS
DECONTAMINATION EFFICIENCYDECONTAMINATION EQUIPMENT
DECONTAMINATION FACTORDECONTAMINATION FLUID
DECONTAMINATION INDEXDECONTAMINATION INSTALLATION
DECONTAMINATION KITDECONTAMINATION MATERIAL
DECONTAMINATION OF AIRDECONTAMINATION OF FUEL
DECONTAMINATION OF SURFACEDECONTAMINATION OF VIRUSES
DECONTAMINATION OPERATIONSDECONTAMINATION PLANT
DÉCONTAMINATION RADIOACTIVEDECONTAMINATION SHOWER FACILITIES
DECONTAMINATION SINKDECONTAMINATION SOLUTION
DECONTAMINATION STATIONDECONTAMINATION SYSTEM
DÉCONTAMINATION THERMOCATALYTIQUEDECONTAMINATION UNIT
DECONTAMINATION WATERING TANKERDECONTAMINATION WORK
DECONTAMINATIONSDECONTAMINATOR
DECONTAMINAZIONEDÉCONTAMINER
DECONTAREDÉCONTENANCÉ
DÉCONTENANCÉEDÉCONTENANCER
DECONTESTUALIZZAREDECONTESTUALIZZAZIONE
DECONTNDECONTOR
DÉCONTRACTÉDÉCONTRACTÉE
DÉCONTRACTERDÉCONTRACTION
DÉCONTRACTION MUSCULAIREDECONTRARRE
DECONTRARSIDECONTRATTO
DECONTRATTURANTEDECONTRAZIONE
DECONTROLDECONTROL BILL
DECONTROL PRICESDECONTROLLED PRICES
DECONTROLLED ROADDECONTROLLING
DECONTROVELACCINODECONTROVELACCIO
DÉCONVENTIONNEMENTDÉCONVENTIONNER
DÉCONVENUEDECONVERT
DECONVOLUTIONDÉCONVOLUTION
DECONVOLUTION (DECON) AMPLITUDEDECONVOLUTION AFTER STACK
DECONVOLUTION ANALYSISDECONVOLUTION BEFORE STACK
DECONVOLUTION FILTERDÉCONVOLUTION HOLOGRAPHIQUE
DECONVOLUTION OPERATORDECONVOLUTION PANEL
DECONVOLUTION PROCEDUREDECONVOLUTION SETTING
DECONVOLVEDECONVOLVED
DECONVULTIONDECOPIA
DECOPPERINGDECOPPERIZATION
DECOPPERIZEDECOPPERIZED LEAD
DECOPPETDECOQUERE
DECOQUINATEDECOQUO
DECORDÉCOR
DECOR FR.DECORA
DECORAÇÃODECORACIÓN
DECORADODECORADO EN LA SUPERFICIE DEL MOLDE
DECORADORDECORAMEN
DECORAMENTUMDECORAR
DECORAREDECORAT
DECORATEDECORATE SOMEONE FOR SOMETHING
DECORATE SOMETHING WITH SOMETHINGDECORATE WITH AN ORDER
DECORATEDDECORATED BY TOOLING
DECORATED CHITONDECORATED COVER
DECORATED CRYSTALDECORATED DISLOCATION
DECORATED LETTERDECORATED NAME
DECORATED SPINEDECORATED STYLE
DECORATED SURFACEDECORATED WITH GOLD
DECORATED WITH RED BANNER ORDERDECORATES
DECORATEURDÉCORATEUR
DECORATIEDECORAŢIE
DECORATIEFDECORATIESCHILDER
DÉCORATIFDECORATING
DECORATING ALLOWANCEDECORATING FIRE
DECORATING PARTICLEDECORATION
DÉCORATIONDECORATION COST
DECORATION DAYDÉCORATION EN GLAÇURE
DECORATION FACILITIESDECORATION IN GOLD
DECORATION METHODDECORATION OF DISLOCATIONS
DECORATION OF OFFICES WITH MAPSDÉCORATION PAR MICROBULLES
DECORATION PLASTERDÉCORATION SOUS GLAÇURE
DÉCORATION SUR GLAÇUREDECORATION TECHNIQUE
DECORATIONSDECORATIONS, PONTIFICAL
DECORAŢIUNEDECORATIV
DECORATIVEDÉCORATIVE
DECORATIVE AGGREGATEDECORATIVE APPEARANCE
DECORATIVE ARTDECORATIVE BED
DECORATIVE BLOCKDECORATIVE BOND
DECORATIVE BORDERDECORATIVE COAT
DECORATIVE COATINGDECORATIVE COLOUR
DECORATIVE ELEMENTDECORATIVE FINISH
DECORATIVE FITTINGDECORATIVE GLASS
DECORATIVE INITIALDECORATIVE INK
DECORATIVE LAMINATEDECORATIVE LAMINATES
DECORATIVE LIGHTINGDECORATIVE LIGHTING SET
DECORATIVE LUMINAIREDECORATIVE MOULDING
DECORATIVE PAINTDECORATIVE PANEL
DECORATIVE PAPERDECORATIVE PLANT
DECORATIVE SHEETDECORATIVE STYLE
DECORATIVE SURGERYDECORATIVE THREAD
DECORATIVISMODECORATIVO
DECORATODECORATOR
DECORATOR CRABDECORATORE
DECORATORSDÉCORATRICE
DECORATUSDECORAZIONE
DECORAZIONE DI DISLOCAZIONIDÉCORDER
DECOREDÉCORÉ
DÉCORÉEDECOREOGRAPHER
DÉCORERDECOREREN
DECORINDECORIO
DÉCORISTEDECORITER
DECORNAREDÉCORNER
DECORODECORONTWERPER
DECOROSODECOROSUS
DECOROSUS, S.DECOROUS
DECOROUSLYDECORRELATION
DECORRELATION MECHANISMDECORRENDO
DECORRENTEDECORRENZA
DECORRERDECORRERE
DECORRIDODECORS
DECORSODECORSO DELLA MALATTIA
DECORSO DELLA REAZIONEDECORSO INGRAVESCENTE DI UNA MALATTIA
DECORSO POSTOPERATORIODECORTECAZIONE
DÉCORTÈNEDECORTICA
DECORTICACIÓNDÉCORTICAGE
DECORTICARDECORTICARE
DECORTICATDECORTICATE
DECORTICATE RIGIDITYDECORTICATIO
DECORTICATIONDÉCORTICATION
DÉCORTICATION DU TESTICULEDECORTICATION OF ADVENTITIAL COAT OF ARTERY
DECORTICATION OF JAWDECORTICATION OF LUNG
DECORTICATION OF LUNGSDECORTICATION OF THE JAW
DÉCORTICATION PLEURALEDÉCORTICATION RÉNALE
DECORTICATORDECORTICATORE
DECORTICATRICEDECORTICAZIONE
DECORTICAZIONE RENALEDECORTICO
DÉCORTINEDÉCORTIQUÉ
DÉCORTIQUÉEDÉCORTIQUER
DÉCORTIQUEURDÉCORTIQUEUSE
DECORTIZATIONDECORTIZATION OF ADVENTITIAL COAT OF ARTERY
DECORTIZATION OF LUNGSDECORUM
DECŌRUMDÉCORUM
DECORUMSDECORUS
DÉCOSIDEDECOSTRUTTIVISMO
DECOTADODECOTAR
DECOTARSEDECOTE
DÉCOTEDÉCOTE EN BOURSE
DECOTEXDÉCOTEX
DECOTTODÉCOUCHER
DÉCOUDREDÉCOULANT
DÉCOULEMENTDÉCOULER
DECOUPAGEDÉCOUPAGE
DÉCOUPAGE D'IMPULSION GÉANTEDÉCOUPAGE D'INFORMATION
DÉCOUPAGE DE FORMESDÉCOUPAGE DU VERRE
DÉCOUPAGE ÉLECTORALDÉCOUPAGE EN AMPLITUDE
DÉCOUPAGE EN NIVEAUDÉCOUPAGE OXYACÉTYLÉNIQUE
DÉCOUPEDÉCOUPÉ
DÉCOUPÉEDÉCOUPER
DÉCOUPEURDÉCOUPEUR DU FAISCEAU
DÉCOUPEUSEDÉCOUPEUSE À GUILLOTINE
DÉCOUPEUSE DE PLAQUESDECOUPIERMASCHINE
DECOUPIERSÄGEDÉCOUPLAGE
DÉCOUPLAGE DE SPINDÉCOUPLAGE DES PROTONS
DÉCOUPLAGE DES SPINSDÉCOUPLAGE OPTIQUE
DECOUPLEDÉCOUPLÉ
DECOUPLE CAPACITYDECOUPLE CIRCUITS
DECOUPLEDDECOUPLED EQUATIONS
DECOUPLED FROMDECOUPLED OUTLET
DÉCOUPLÉEDECOUPLER
DÉCOUPLERDECOUPLER VALVE
DECOUPLIGDECOUPLING
DECOUPLING ABSORBERDECOUPLING ALGORITHM
DECOUPLING CAPACITORDECOUPLING FILTER
DECOUPLING NETWORKDECOUPLING RATIO
DECOUPLING RESISTORDECOUPLING STOCK
DECOUPLING THE LATERAL AND LONGITUDINAL MOTIONSDECOUPLING UNIT
DÉCOUPOIRDÉCOUPOIR À COL DE CYGNE
DÉCOUPUREDÉCOUPURES
DÉCOURAGÉDÉCOURAGEANT
DÉCOURAGEANTEDÉCOURAGÉE
DÉCOURAGEMENTDÉCOURAGER
DECOURAGIERENDECOURAGIERT
DÉCOURBERDÉCOURONNEMENT
DÉCOURONNERDÉCOURS
DÉCOURS DE L'OPÉRATIONDECOURT
DÉCOUSUDÉCOUSUE
DÉCOUSUREDECOUVERT
DÉCOUVERTDÉCOUVERT AUTORISÉ
DÉCOUVERT BUDGÉTAIREDÉCOUVERT DE COMPTE
DÉCOUVERT DE LA LOI DE FINANCESDÉCOUVERT DE TRÉSORERIE
DÉCOUVERT NON RÉGLÉDÉCOUVERT OBLIGATOIRE
DÉCOUVERT RÉGLÉDÉCOUVERTE
DÉCOUVERTE DE FAITS NOUVEAUXDÉCOUVERTE DES LOIS
DÉCOUVERTE DES MALFORMATIONS CONGÉNITALESDÉCOUVERTE DES MARCHANDISES DE FRAUDE
DÉCOUVERTE DES PANNESDÉCOUVERTE DU CALCUL
DÉCOUVERTE FORTUITE DES TUMEURS DU PARENCHYME RÉNALDÉCOUVERTE SCIENTIFIQUE
DÉCOUVERTUREDÉCOUVREUR
DECOUVRIERENDÉCOUVRIR
DÉCOUVRIR L'AMÉRIQUEDÉCOUVRIR LA MINE
DÉCOUVRIR LA PEAUDÉCOUVRIR LE NOUVEAU MONDE
DÉCOUVRIR LE POT AUX ROSESDÉCOUVRIR LES CANINES
DÉCOUVRIR SON ÂME À NUDÉCOUVRIR UNE MINE
DÉCOUVRIR/DÉVOILER LE POT AUX ROSESDECOVER
DECOVILDECOXI
DECOYDECOY AID
DECOY BATTERYDECOY BIRD
DECOY CAMERADECOY CAPABILITY
DECOY CLOUDDECOY COUNTERGLOW
DECOY DEVICEDECOY DISCRIMINATION
DECOY DISCRIMINATION RADARDECOY DUCK
DECOY ECHODECOY ENVIRONMENT
DECOY IDENTIFICATIONDECOY LAUNCHING
DECOY LAUNCHING SITEDECOY MARKETING
DECOY MISSILEDECOY MISSILE LAUNCHING
DECOY NAMEDECOY POND
DECOY POSITIONDECOY RETURN
DECOY ROADDECOY ROCKET
DECOY SALVODECOY SATELLITE
DECOY SHAPINGDECOY SHIP
DECOY SORTING RADARDECOY TREE
DECOY WARHEADDECOY WEAPON
DECOY WORKDECOYDISCRIMINATION TECHNIQUE
DECOYDUCKDECOYED
DECOYINGDECOYS
DECOYSHIPDECOZIONE
DECRDECR.
DECRABDECRAB MANEUVER
DÉCRAMPONNERDÉCRAPOUILLER
DÉCRASSAGEDÉCRASSAGE D'UN FOYER
DÉCRASSEMENTDÉCRASSER
DÉCRASSER SA MÉMOIREDÉCRASSEUR
DÉCRASSEUR À RACLETTESDÉCRASSOIR
DECRATERDECREASE
DECREASE ... PROFITABILITYDECREASE CRIME
DECREASE CRIME RATEDECREASE CRUDE OIL PRODUCTION
DECREASE IDECREASE II
DECREASE IN ASSETSDECREASE IN DEPOSITS
DECREASE IN DIPDECREASE IN EXPORTS
DECREASE IN IMPORTSDECREASE IN JOB
DECREASE IN LONGTERM LOANDECREASE IN POPULATION
DECREASE IN PRICEDECREASE IN REMAINING MATURITY
DECREASE IN SMTH.DECREASE IN SPEED
DECREASE IN TENSIONSDECREASE IN THE INFLATION RATE
DECREASE IN THE MASS OF CIRCULATING BLOODDECREASE IN TRADE
DECREASE IN TUBE WALL THICKNESSDECREASE IN VALUE
DECREASE IN VALUE OF SHARESDECREASE INDENT
DECREASE LOSSESDECREASE OF ADDENDUM
DECREASE OF DRILLING SPEEDDECREASE OF EARNING CAPACITY
DECREASE OF FUNCTIONDECREASE OF PAY
DECREASE OF RISKDECREASE OF TEMPERATURE
DECREASE OF WORKING CAPITALDECREASE SEVERAL TIMES
DECREASE SIGNALDECREASE TENSIONS
DECREASE THE VOLUMEDECREASE THE WEIGHT ON BIT
DECREASE THE WEIGHT ON THE BITDECREASE TO ZERO
DECREASE VOLTAGEDECREASED
DECREASED BODY PILOSISDECREASED EROSION
DECREASED LIFTDECREASED RESPONSE
DECREASED SPACINGDECREASES
DECREASINGDECREASING ACCELERATION HEAD
DECREASING ANNUITYDECREASING BEHAVIOR
DECREASING COSTDECREASING COST INDUSTRY
DECREASING COSTSDECREASING CURVE
DECREASING DEMANDDECREASING DOGLEG
DECREASING FACTORDECREASING FAILURE ITEM
DECREASING FAILURE RATEDECREASING FAILURE RATE AVERAGE
DECREASING FAILURE RATE PERIODDECREASING FILTRATION
DECREASING FUNCTIONDECREASING HAZARD RATE
DECREASING LEAD SCREWDECREASING MEASURE
DECREASING MURMURDECREASING OF NONUNIFORMITY OF CHAIN MOTION
DECREASING OF SULPHUR CONTENTDECREASING POPULATION
DECREASING PROGRESSIONDECREASING QUANTITY
DECREASING RETURNDECREASING RETURNS
DECREASING RETURNS OF SCALEDECREASING RETURNS OF THE SCALE
DECREASING RETURNS TO SCALEDECREASING SECTION
DECREASING SEQUENCEDECREASING SERIES
DECREASING SETDECREASING SIDELOBE PATTERN
DECREASING SPACEDECREASING SPECIES
DECREASING SPEEDDECREASING STRING
DECREASING TAXADECREASING TERM ASSURANCE
DECREASING TERM INSURANCEDECREASING TERM LIFE INSURANCE
DECREASING TERM POLICYDECREASING UTILITY
DECREASING WAVEDECREASINGLY
DECRECENCIADECRECER
DECRECIENTEDECRECIMIENTO
DECRECIMIENTO ABSOLUTODECRECIMIENTO DEL IMPULSO
DECRECIMIENTO ECONÓMICODECRECIMIENTO LINEAL
DECRECIMIENTO LOGARITMICODECRECIMIENTO RELATIVO
DÉCRÉDIBILISATIONDÉCRÉDIBILISER
DÉCRÉDITEMENTDÉCRÉDITER
DECREEDECREE ABSOLUTE
DECREE EXTRAORDINARYDECREE IN BANKRUPTCY
DECREE NEW IMPOSITIONDECREE NISI
DECREE NISI OF DISSOLUTION OF MARRIAGEDECREE OF CONDEMNATION
DECREE OF COURTDECREE OF FORECLOSURE AND SALE
DECREE OF INDEMNITYDECREE OF JUDICIAL SEPARATION
DECREE OF NATUREDECREE OF NULLITY
DECREE OF PEACEDECREE OF RESTITUTION
DECREE OF THE COURTDECREE OF THE SUPREME SOVIET OF THE USSR
DECREE ON LANDDECREE ON PEACE
DECREE ON STATE BORDER CROSSING AND CUSTOMS CONTROL PROCEDURES FOR THE CONSTRUCTION OF THE VITYAZ PRODUCTION COMPLEXDECREE PRO CONFESSO
DECREE:DECREED
DECREED MOSCOW TIMEDECREELAW
DECREESDECREES NISI
DECREES OF GODDECREET
DECREET ABSOLVITORDECREET CONDEMNATOR
DECREMENTDÉCRÉMENT
DECREMENT BY ONEDECREMENT COUNTER
DECREMENT CURVEDÉCRÉMENT D'AMORTISSEMENT
DÉCRÉMENT D'AMPLITUDEDÉCRÉMENT DE PHASE
DECREMENT FAULTDECREMENT FIELD
DECREMENT GAUGEDÉCRÉMENT LOGARITHMIQUE
DECREMENT OF ROLLDECREMENT OF VISUAL ACUITY
DECREMENT OPERATIONDECREMENT OPERATOR
DECREMENTAL CONDUCTIBILITYDECREMENTAL CONDUCTION
DECREMENTAL HARDENINGDECREMENTAL NEIGHBORHOOD METHOD
DECREMENTAL OPERATORDECREMENTARE
DECREMENTINGDECREMENTING KEY
DECREMENTODECREMENTO DE LAS OSCILACIONES
DECREMENTO DELLA FUNZIONEDECREMENTO DI ENERGIA
DECREMENTO DI IRRADIAZIONEDECREMENTO DI OSCILLAZIONI
DECREMENTO DI SMORZAMENTODECREMENTO DISSIPATIVO
DECREMENTO ESPONENZIALEDECREMENTO LINEARE
DECREMENTO LOGARITMICODECREMENTO MONOTONO
DECREMENTO RADIOATTIVODECREMENTS
DECREMENTUMDECREMETER
DÉCRÉMÈTREDECREMETRO
DECREMODÉCRÊPAGE
DÉCRÊPERDÉCRÉPI
DECREPIDEZDÉCRÉPIE
DÉCRÉPIRDÉCRÉPISSAGE
DECREPITDÉCRÉPIT
DECREPIT HORSEDECREPIT STATE
DECREPITÀDECREPITACION
DECREPITACIÓNDECREPITAR
DECREPITAREDECREPITATE
DECREPITATEDDECREPITATING
DECREPITATIONDÉCRÉPITATION
DECREPITATION METHODDECREPITATION TECHNIQUE
DECREPITAZIONEDÉCRÉPITE
DÉCRÉPITERDECREPITEZZA
DECREPITODECRÉPITO
DECREPITUDDECREPITUDE
DÉCRÉPITUDEDECREPITUDINE
DECREPITUSDECRESC.
DÉCRESCENCEDECRESCENDO
DECRESCENDO, ИЛИ DECDECRESCENDOGERÄUSCH
DECRESCENTDECRESCENTE
DECRESCENTIADECRESCENZA
DECRESCERDECRESCERE
DECRESCIMENTODECRESCO
DECRETDÉCRET
DÉCRET AUTONOMEDÉCRET D'AMNISTIE
DÉCRET D'APPLICATION (DE LA LOI)DÉCRET D'AVANCES
DÉCRET D'EXPULSIONDÉCRET DE CONVOCATION
DÉCRET DE GRACEDÉCRET DE PROMULGATION
DÉCRET DE RÉPARTITIONDÉCRET EN CONSEIL D'ETAT
DÉCRET INDIVIDUELLEDÉCRET RÉGLEMENTAIRE
DECRETADECRETADA
DECRETADODECRETAL
DECRETAL ORDERDECRETALE
DÉCRÉTALEDECRETALI
DECRETALISDECRETALISTA
DECRETALS, PAPALDECRETAR
DECRETAR DEJAR ABIERTA LA AVERIGUACIÓNDECRETAR EL EMBARGO
DECRETAR EL PARODECRETAR HONORES PÚBLICOS
DECRETAR LA DETENCIÓNDECRETAR LA HUELGA
DECRETAR LA TERMINACIÓN DE LA AVERIGUACIÓNDECRETAR ORDEN DE BUSCA Y CAPTURA INTERNACIONAL
DECRETAR ORDENANZADECRETAR UN DIVIDENDO
DECRETAR UNA LEYDECRETAR UNA PENA
DECRETAREDECRETARE UN EMBARGO
DECRÉTASEDECRETAZIONE
DÉCRÉTERDÉCRÉTER QN DE PRISE DE CORPS
DECRETERENDECRETERO
DECRETISTADECRETIVE
DECRETIVE DECRETORYDÉCRETLOI
DECRETODECRETO CON FUERZA DE LEY
DECRETO DE CAJÓNDECRETO DE DETENCIÓN
DECRETO DE EXHIBICIÓNDECRETO DE INSISTENCIA
DECRETO DE NACIONALIZACIÓNDECRETO DE NO HA LUGAR
DECRETO DE SUSTANCIACIÓNDECRETO DEL CONSEJO DE MINISTROS
DECRETO DEL GOBIERNODECRETO DEL JEFE DEL ESTADO
DECRETO DI CHIUSURA DEL FALLIMENTODECRETO DI CITAZIONE IN GIUDIZIO
DECRETO DI CONFISCADECRETO DI PERQUISIZIONE
DECRETO EJECUTIVODECRETO EXENTO
DECRETO GUBERNAMENTALDECRETO JUDICIAL
DECRETO LEGGEDECRETO LEGISLATIVO
DECRETO MINISTERIALEDECRETO NORMATIVO
DECRETO OFICIALDECRETO POR CONSENTIMIENTO
DECRETO PRESIDENZIALEDECRETO QUE TIENE FUERZA DE LEGISLATIVA
DECRETO RESOLUTORIODECRETO S.
DECRETO SUPREMODECRETOLEY
DECRETOREGLAMENTODECRETÓRIO
DECRETORIUSDECRETORY
DECRETORY SENTENCEDECRETORY SENTENCING
DECRETUMDÉCREUSAGE
DÉCREUSEMENTDÉCREUSER
DECREVIDÉCRI
DECRIALDÉCRIÉ
DECRIEDDÉCRIER
DÉCRIER SA MARCHANDISEDECRIES
DÉCRIMINALISATIONDÉCRIMINALISER
DECRIMINALIZACIÓNDECRIMINALIZAR
DECRIMINALIZATIONDECRIMINALIZATION OF ABORTION
DECRIMINALIZATION OF DRUGSDECRIMINALIZE
DECRIMINALIZE DRUGSDECRIMINALIZING DRUGS
DECRIMINALIZZAREDECRIMINALIZZAZIONE
DECRIPTAREDECRIPTAZIONE
DÉCRIQUAGEDÉCRIQUEUR
DÉCRIQUEUSEDÉCRIRE
DÉCRISPATIONDÉCRISPER
DECRISTALLIZZAZIONEDECRITTARE
DECRITTAZIONEDÉCRO
T: 284